• Gene id: 1399

Gene Summary

• Gene Symbol: CRKL   Gene   UCSC   Ensembl
• Gene name: CRK like proto-oncogene, adaptor protein
• Alternate names: crk-like protein, v-crk avian sarcoma virus CT10 oncogene homolog-like,
• Gene location: 22q11.21 (20917406: 20953746)     Exons: 4     NC_000022.11
• Gene summary(Entrez): This gene encodes a protein kinase containing SH2 and SH3 (src homology) domains which has been shown to activate the RAS and JUN kinase signaling pathways and transform fibroblasts in a RAS-dependent fashion. It is a substrate of the BCR-ABL tyrosine kin
• OMIM: 604620

Protein Summary

• Protein general information: P46109  
  • Name: Crk like protein
  • Length: 303  
  • Mass: 33777
• Sequence:

  MSSARFDSSDRSAWYMGPVSRQEAQTRLQGQRHGMFLVRDSSTCPGDYVLSVSENSRVSHYIINSLPNRRFKIGD
  QEFDHLPALLEFYKIHYLDTTTLIEPAPRYPSPPMGSVSAPNLPTAEDNLEYVRTLYDFPGNDAEDLPFKKGEIL
  VIIEKPEEQWWSARNKDGRVGMIPVPYVEKLVRSSPHGKHGNRNSNSYGIPEPAHAYAQPQTTTPLPAVSGSPGA
  AITPLPSTQNGPVFAKAIQKRVPCAYDKTALALEVGDIVKVTRMNINGQWEGEVNGRKGLFPFTHVKIFDPQNPD
  ENE

• Structural information:
  • Protein Domains: (14..10-)
    (/note="SH2-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00191-)
    (123..18-)
    (/note="SH3-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00192-)
    (235..29-)
    (/note="SH3-2)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00192"-)
  • Interpro: IPR035458  IPR035457  IPR000980  IPR036860  IPR036028   IPR001452  
  • Prosite: PS50001 PS50002
  • CDD: cd11759 cd11758
  • PDB: 2BZX 2BZY 2DBK 2EO3 2LQN 2LQW
  • PDBsum: 2BZX 2BZY 2DBK 2EO3 2LQN 2LQW
  • DIP: 29165
  • STRING: ENSP00000346300
• Other Databases: GeneCards:  CRKL  Malacards:  CRKL

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:1903977	positive regulation of glial cell migration	IMP	biological process
GO:0070374	positive regulation of ERK1 and ERK2 cascade	IMP	biological process
GO:0001933	negative regulation of protein phosphorylation	IMP	biological process
GO:0010629	negative regulation of gene expression	IMP	biological process
GO:0071560	cellular response to transforming growth factor beta stimulus	IMP	biological process
GO:0001934	positive regulation of protein phosphorylation	IMP	biological process
GO:0008284	positive regulation of cell population proliferation	IMP	biological process
GO:1900026	positive regulation of substrate adhesion-dependent cell spreading	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0035556	intracellular signal transduction	TAS	biological process
GO:0007254	JNK cascade	TAS	biological process
GO:0007265	Ras protein signal transduction	TAS	biological process
GO:0000186	activation of MAPKK activity	TAS	biological process
GO:0046579	positive regulation of Ras protein signal transduction	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0019221	cytokine-mediated signaling pathway	TAS	biological process
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0000187	activation of MAPK activity	IEA	biological process
GO:0001558	regulation of cell growth	IEA	biological process
GO:0001655	urogenital system development	IEA	biological process
GO:0001764	neuron migration	IEA	biological process
GO:0001783	B cell apoptotic process	IEA	biological process
GO:0007283	spermatogenesis	IEA	biological process
GO:0007338	single fertilization	IEA	biological process
GO:0009887	animal organ morphogenesis	IEA	biological process
GO:0009952	anterior/posterior pattern specification	IEA	biological process
GO:0016358	dendrite development	IEA	biological process
GO:0021766	hippocampus development	IEA	biological process
GO:0030010	establishment of cell polarity	IEA	biological process
GO:0032991	protein-containing complex	IEA	cellular component
GO:0035685	helper T cell diapedesis	IEA	biological process
GO:0035690	cellular response to drug	IEA	biological process
GO:0048538	thymus development	IEA	biological process
GO:0050773	regulation of dendrite development	IEA	biological process
GO:0060017	parathyroid gland development	IEA	biological process
GO:0060465	pharynx development	IEA	biological process
GO:0086100	endothelin receptor signaling pathway	IEA	biological process
GO:0090630	activation of GTPase activity	IEA	biological process
GO:1904393	regulation of skeletal muscle acetylcholine-gated channel clustering	IEA	biological process
GO:0001568	blood vessel development	IEA	biological process
GO:0002685	regulation of leukocyte migration	IEA	biological process
GO:0003151	outflow tract morphogenesis	IEA	biological process
GO:0006629	lipid metabolic process	IEA	biological process
GO:0007389	pattern specification process	IEA	biological process
GO:0007416	synapse assembly	IEA	biological process
GO:0007507	heart development	IEA	biological process
GO:0008543	fibroblast growth factor receptor signaling pathway	IEA	biological process
GO:0008584	male gonad development	IEA	biological process
GO:0010468	regulation of gene expression	IEA	biological process
GO:0021987	cerebral cortex development	IEA	biological process
GO:0031594	neuromuscular junction	IEA	cellular component
GO:0033628	regulation of cell adhesion mediated by integrin	IEA	biological process
GO:0038026	reelin-mediated signaling pathway	IEA	biological process
GO:0045202	synapse	IEA	cellular component
GO:0048384	retinoic acid receptor signaling pathway	IEA	biological process
GO:0050852	T cell receptor signaling pathway	IEA	biological process
GO:0060326	cell chemotaxis	IEA	biological process
GO:0070374	positive regulation of ERK1 and ERK2 cascade	IEA	biological process
GO:0071774	response to fibroblast growth factor	IEA	biological process
GO:0095500	acetylcholine receptor signaling pathway	IEA	biological process
GO:0098749	cerebellar neuron development	IEA	biological process
GO:0098761	cellular response to interleukin-7	IEA	biological process
GO:0098890	extrinsic component of postsynaptic membrane	IEA	cellular component
GO:1904888	cranial skeletal system development	IEA	biological process
GO:2000404	regulation of T cell migration	IEA	biological process
GO:0045296	cadherin binding	HDA	molecular function
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0001784	phosphotyrosine residue binding	IPI	molecular function
GO:0001784	phosphotyrosine residue binding	IPI	molecular function
GO:0003723	RNA binding	HDA	molecular function

KEGG pathways

Pathway id	Pathway name
hsa05200	Pathways in cancer
hsa04010	MAPK signaling pathway
hsa05206	MicroRNAs in cancer
hsa05131	Shigellosis
hsa04810	Regulation of actin cytoskeleton
hsa04015	Rap1 signaling pathway
hsa05163	Human cytomegalovirus infection
hsa04062	Chemokine signaling pathway
hsa04510	Focal adhesion
hsa05170	Human immunodeficiency virus 1 infection
hsa04910	Insulin signaling pathway
hsa05135	Yersinia infection
hsa04722	Neurotrophin signaling pathway
hsa04935	Growth hormone synthesis, secretion and action
hsa04666	Fc gamma R-mediated phagocytosis
hsa04012	ErbB signaling pathway
hsa05100	Bacterial invasion of epithelial cells
hsa05220	Chronic myeloid leukemia
hsa05211	Renal cell carcinoma

Diseases

Associated diseases	References
Prostate cancer	PMID:16391854
Colon carcinoma	PMID:16391854
Ovarian cancer	PMID:16391854
invasive ductal carcinoma	PMID:23686806
lung carcinoma	PMID:16391854
skin cancer	PMID:16391854
chronic myeloid leukemia	PMID:17900686
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R