• Gene id: 1398

Gene Summary

• Gene Symbol: CRK   Gene   UCSC   Ensembl
• Aliases: CRKII, p38
• Gene name: CRK proto-oncogene, adaptor protein
• Alternate names: adapter molecule crk, proto-oncogene c-Crk, v-crk avian sarcoma virus CT10 oncogene homolog, v-crk sarcoma virus CT10 oncogene-like protein,
• Gene location: 17p13.3 (1456231: 1420692)     Exons: 3     NC_000017.11
• Gene summary(Entrez): This gene encodes a member of an adapter protein family that binds to several tyrosine-phosphorylated proteins. The product of this gene has several SH2 and SH3 domains (src-homology domains) and is involved in several signaling pathways, recruiting cytop
• OMIM: 174760

Protein Summary

• Protein general information: P46108  
  • Name: Adapter molecule crk (Proto oncogene c Crk) (p38)
  • Length: 304  
  • Mass: 33831
• Sequence:

  MAGNFDSEERSSWYWGRLSRQEAVALLQGQRHGVFLVRDSSTSPGDYVLSVSENSRVSHYIINSSGPRPPVPPSP
  AQPPPGVSPSRLRIGDQEFDSLPALLEFYKIHYLDTTTLIEPVSRSRQGSGVILRQEEAEYVRALFDFNGNDEED
  LPFKKGDILRIRDKPEEQWWNAEDSEGKRGMIPVPYVEKYRPASASVSALIGGNQEGSHPQPLGGPEPGPYAQPS
  VNTPLPNLQNGPIYARVIQKRVPNAYDKTALALEVGELVKVTKINVSGQWEGECNGKRGHFPFTHVRLLDQQNPD
  EDFS

• Structural information:
  • Protein Domains: (13..11-)
    (/note="SH2-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00191-)
    (132..19-)
    (/note="SH3-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00192-)
    (235..29-)
    (/note="SH3-2)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00192"-)
  • Interpro: IPR035458  IPR035457  IPR000980  IPR036860  IPR036028   IPR001452  
  • Prosite: PS50001 PS50002
  • CDD: cd11759 cd11758
  • PDB: 1JU5 2DVJ 2EYV 2EYW 2EYX 2EYY 2EYZ 2MS4 5UL6 6ATV
  • PDBsum: 1JU5 2DVJ 2EYV 2EYW 2EYX 2EYY 2EYZ 2MS4 5UL6 6ATV
  • DIP: 199
  • STRING: ENSP00000300574
• Other Databases: GeneCards:  CRK  Malacards:  CRK

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0048013	ephrin receptor signaling pathway	IDA	biological process
GO:0032956	regulation of actin cytoskeleton organization	IDA	biological process
GO:0043087	regulation of GTPase activity	IDA	biological process
GO:0005737	cytoplasm	IC	cellular component
GO:0046875	ephrin receptor binding	IPI	molecular function
GO:0030036	actin cytoskeleton organization	IMP	biological process
GO:0008360	regulation of cell shape	IMP	biological process
GO:1900026	positive regulation of substrate adhesion-dependent cell spreading	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005634	nucleus	TAS	cellular component
GO:0006357	regulation of transcription by RNA polymerase II	TAS	biological process
GO:0000186	activation of MAPKK activity	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0019221	cytokine-mediated signaling pathway	TAS	biological process
GO:0038096	Fc-gamma receptor signaling pathway involved in phagocytosis	TAS	biological process
GO:0048010	vascular endothelial growth factor receptor signaling pathway	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0001878	response to yeast	IEA	biological process
GO:0005159	insulin-like growth factor receptor binding	IEA	molecular function
GO:0014911	positive regulation of smooth muscle cell migration	IEA	biological process
GO:0019899	enzyme binding	IEA	molecular function
GO:0019904	protein domain specific binding	IEA	molecular function
GO:0030674	protein-macromolecule adaptor activity	IEA	molecular function
GO:0035020	regulation of Rac protein signal transduction	IEA	biological process
GO:0035728	response to hepatocyte growth factor	IEA	biological process
GO:0042542	response to hydrogen peroxide	IEA	biological process
GO:0061847	response to cholecystokinin	IEA	biological process
GO:0071732	cellular response to nitric oxide	IEA	biological process
GO:0097110	scaffold protein binding	IEA	molecular function
GO:1901652	response to peptide	IEA	biological process
GO:1990314	cellular response to insulin-like growth factor stimulus	IEA	biological process
GO:1990782	protein tyrosine kinase binding	IEA	molecular function
GO:1990859	cellular response to endothelin	IEA	biological process
GO:0002685	regulation of leukocyte migration	IEA	biological process
GO:0006629	lipid metabolic process	IEA	biological process
GO:0021987	cerebral cortex development	IEA	biological process
GO:0032956	regulation of actin cytoskeleton organization	IEA	biological process
GO:0033628	regulation of cell adhesion mediated by integrin	IEA	biological process
GO:0038026	reelin-mediated signaling pathway	IEA	biological process
GO:0060326	cell chemotaxis	IEA	biological process
GO:0098749	cerebellar neuron development	IEA	biological process
GO:2000404	regulation of T cell migration	IEA	biological process
GO:0008092	cytoskeletal protein binding	IEA	molecular function
GO:0045121	membrane raft	IEA	cellular component
GO:0045953	negative regulation of natural killer cell mediated cytotoxicity	IEA	biological process
GO:0071560	cellular response to transforming growth factor beta stimulus	IEA	biological process
GO:1990090	cellular response to nerve growth factor stimulus	IEA	biological process
GO:0001764	neuron migration	IEA	biological process
GO:0015629	actin cytoskeleton	IEA	cellular component
GO:0016358	dendrite development	IEA	biological process
GO:0021766	hippocampus development	IEA	biological process
GO:0030010	establishment of cell polarity	IEA	biological process
GO:0035685	helper T cell diapedesis	IEA	biological process
GO:0045309	protein phosphorylated amino acid binding	IEA	molecular function
GO:0046875	ephrin receptor binding	IEA	molecular function
GO:0050773	regulation of dendrite development	IEA	biological process
GO:0090630	activation of GTPase activity	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0001784	phosphotyrosine residue binding	IPI	molecular function
GO:0008360	regulation of cell shape	IMP	biological process
GO:2000146	negative regulation of cell motility	IDA	biological process
GO:2000146	negative regulation of cell motility	IMP	biological process
GO:0043393	regulation of protein binding	IMP	biological process
GO:0032991	protein-containing complex	IPI	cellular component
GO:0061045	negative regulation of wound healing	IMP	biological process
GO:1990782	protein tyrosine kinase binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0017124	SH3 domain binding	IPI	molecular function
GO:0035591	signaling adaptor activity	IDA	molecular function
GO:0035591	signaling adaptor activity	IDA	molecular function
GO:0061045	negative regulation of wound healing	IDA	biological process
GO:0009966	regulation of signal transduction	IDA	biological process
GO:0045309	protein phosphorylated amino acid binding	IDA	molecular function
GO:0043621	protein self-association	IDA	molecular function
GO:1902531	regulation of intracellular signal transduction	IDA	biological process
GO:0070062	extracellular exosome	HDA	cellular component
GO:0042169	SH2 domain binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa05200	Pathways in cancer
hsa04010	MAPK signaling pathway
hsa05206	MicroRNAs in cancer
hsa05131	Shigellosis
hsa04810	Regulation of actin cytoskeleton
hsa04015	Rap1 signaling pathway
hsa05163	Human cytomegalovirus infection
hsa04062	Chemokine signaling pathway
hsa04510	Focal adhesion
hsa05170	Human immunodeficiency virus 1 infection
hsa04910	Insulin signaling pathway
hsa05135	Yersinia infection
hsa04722	Neurotrophin signaling pathway
hsa04935	Growth hormone synthesis, secretion and action
hsa04666	Fc gamma R-mediated phagocytosis
hsa04012	ErbB signaling pathway
hsa05100	Bacterial invasion of epithelial cells
hsa05220	Chronic myeloid leukemia
hsa05211	Renal cell carcinoma
P06959	CCKR signaling map

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq