About Us

Search Result


Gene id 139735
Gene Summary    Protein Summary    Gene ontology    KEGG pathways    Diseases    PubMed    

Gene Summary

Gene Symbol ZFP92   Gene   UCSC   Ensembl
Aliases ZNF897
Gene name ZFP92 zinc finger protein
Alternate names zinc finger protein 92 homolog, zfp-92, zinc finger protein homologous to Zfp92 in mouse,
Gene location Xq28 (153411460: 153426480)     Exons: 7     NC_000023.11

Protein Summary

Protein general information A6NM28  

Name: Zinc finger protein 92 homolog (Zfp 92)

Length: 416  Mass: 45791

Sequence MAAILLTTRPKVPVSFEDVSVYFTKTEWKLLDLRQKVLYKRVMLENYSHLVSLGFSFSKPHLISQLERGEGPWVA
DIPRTWATAGLHIGDRTQSKTSTSTQKHSGRQLPGADPQGGKEGQAARSSVLQRGAQGLGQSSAAGPQGPKGAEK
RYLCQQCGKAFSRSSNLIKHRIIHSGEKPYACPECGKLFRRSFALLEHQRIHSGEKPYACPECSKTFTRSSNLIK
HQVIHSGERPFACGDCGKLFRRSFALLEHARVHSGERPYACPECGKAFSRSSNLIEHQRTHRGEKPYACGQCAKA
FKGVSQLIHHQRSHSGERPFACRECGKAFRGRSGLSQHRRVHSGEKPYECSDCGKAFGRRANLFKHQAVHGARRP
AKAETARRLAGPGSTGPGSAVAATSPPRPSTAARPSRPSRR
Structural information
Protein Domains
(14..8-)
(/note="KRAB-)
(/evidence="ECO:0000255|PROSITE-ProRule:PRU00119"-)
Interpro:  IPR001909  IPR036051  IPR036236  IPR013087  
Prosite:   PS50805 PS00028 PS50157
CDD:   cd07765
STRING:   ENSP00000462054
Other Databases GeneCards:  ZFP92  Malacards:  ZFP92

Gene ontology

Expand All | Collapse All

GO accessionTerm nameEvidence codeGo category
GO:0003676 nucleic acid binding
IEA molecular function
GO:0006355 regulation of transcripti
on, DNA-templated
IEA biological process
GO:0046872 metal ion binding
IEA molecular function
GO:0005634 nucleus
IEA cellular component
GO:0003677 DNA binding
IEA molecular function
GO:0005634 nucleus
IEA cellular component

KEGG pathways

Expand All | Collapse All

Pathway idPathway name
hsa05168Herpes simplex virus 1 infection
Associated diseases References
Cryptorchidism MIK: 28606200

PubMed references

Expand All | Collapse All

PMID Condition Mutation Ethnicity Population details Infertility_type Associated_genes Abstract
28606200 Cryptorchi
dism

Monozgotic twin
s (1 control, I
cwith cryptorc
hidism)
Male infertility MeDIP-Seq
Show abstract