• Gene id: 139728

Gene Summary

• Gene Symbol: PNCK   Gene   UCSC   Ensembl
• Aliases: BSTK3, CaMK1b
• Gene name: pregnancy up-regulated nonubiquitous CaM kinase
• Alternate names: calcium/calmodulin-dependent protein kinase type 1B, caM kinase I beta, caM kinase IB, caM-KI beta, caMKI-beta, pregnancy up-regulated non-ubiquitously-expressed CaM kinase, pregnancy upregulated non-ubiquitously expressed CaM kinase,
• Gene location: Xq28 (153687770: 153669722)     Exons: 19     NC_000023.11
• Gene summary(Entrez): PNCK is a member of the calcium/calmodulin-dependent protein kinase family of protein serine/threonine kinases (see CAMK1; MIM 604998) (Gardner et al., 2000 [PubMed 10673339]).[supplied by OMIM, Mar 2008]

Protein Summary

• Protein general information: Q6P2M8  
  • Name: Calcium/calmodulin dependent protein kinase type 1B (EC 2.7.11.17) (CaM kinase I beta) (CaM kinase IB) (CaM KI beta) (CaMKI beta) (Pregnancy up regulated non ubiquitously expressed CaM kinase)
  • Length: 343  
  • Mass: 38500
• Sequence:

  MLLLKKHTEDISSVYEIRERLGSGAFSEVVLAQERGSAHLVALKCIPKKALRGKEALVENEIAVLRRISHPNIVA
  LEDVHESPSHLYLAMELVTGGELFDRIMERGSYTEKDASHLVGQVLGAVSYLHSLGIVHRDLKPENLLYATPFED
  SKIMVSDFGLSKIQAGNMLGTACGTPGYVAPELLEQKPYGKAVDVWALGVISYILLCGYPPFYDESDPELFSQIL
  RASYEFDSPFWDDISESAKDFIRHLLERDPQKRFTCQQALRHLWISGDTAFDRDILGSVSEQIRKNFARTHWKRA
  FNATSFLRHIRKLGQIPEGEGASEQGMARHSHSGLRAGQPPKW

• Structural information:
  • Protein Domains: (15..27-)
    (/note="Protein-kinase)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00159"-)
  • Interpro: IPR042696  IPR011009  IPR000719  IPR017441  IPR008271  
  • Prosite: PS00107 PS50011 PS00108
  • CDD: cd14169
  • STRING: ENSP00000405950
• Other Databases: GeneCards:  PNCK  Malacards:  PNCK

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0018105	peptidyl-serine phosphorylation	IBA	biological process
GO:0005516	calmodulin binding	IBA	molecular function
GO:0004683	calmodulin-dependent protein kinase activity	IBA	molecular function
GO:0004674	protein serine/threonine kinase activity	IBA	molecular function
GO:0004683	calmodulin-dependent protein kinase activity	IEA	molecular function
GO:0004672	protein kinase activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0006468	protein phosphorylation	IEA	biological process
GO:0005516	calmodulin binding	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0016301	kinase activity	IEA	molecular function
GO:0016310	phosphorylation	IEA	biological process
GO:0004674	protein serine/threonine kinase activity	IEA	molecular function
GO:0000166	nucleotide binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005524	ATP binding	IEA	molecular function
GO:0004683	calmodulin-dependent protein kinase activity	IEA	molecular function
GO:0004683	calmodulin-dependent protein kinase activity	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq