• Gene id: 139716

Gene Summary

• Gene Symbol: GAB3   Gene   UCSC   Ensembl
• Gene name: GRB2 associated binding protein 3
• Alternate names: GRB2-associated-binding protein 3, DOS/Gab family member 3, GRB2-associated binder 3, Gab3 scaffolding protein, growth factor receptor bound protein 2-associated protein 3,
• Gene location: Xq28 (154751565: 154675248)     Exons: 12     NC_000023.11
• Gene summary(Entrez): This gene is a member of the GRB2-associated binding protein gene family. These proteins are scaffolding/docking proteins that are involved in several growth factor and cytokine signaling pathways, and they contain a pleckstrin homology domain, and bind S

Protein Summary

• Protein general information: Q8WWW8  
  • Name: GRB2 associated binding protein 3 (GRB2 associated binder 3) (Growth factor receptor bound protein 2 associated protein 3)
  • Length: 586  
  • Mass: 65589
• Sequence:

  MSAGDAVCTGWLVKSPPERKLQRYAWRKRWFVLRRGRMSGNPDVLEYYRNKHSSKPIRVIDLSECAVWKHVGPSF
  VRKEFQNNFVFIVKTTSRTFYLVAKTEQEMQVWVHSISQVCNLGHLEDGADSMESLSYTPSSLQPSSASSLLTAH
  AASSSLPRDDPNTNAVATEETRSESELLFLPDYLVLSNCETGRLHHTSLPTRCDSWSNSDRSLEQASFDDVFVDC
  LQPLPSSHLVHPSCHGSGAQEVPSSRPQAALIWSREINGPPRDHLSSSPLLESSLSSTIQVDKNQGSLPCGAKEL
  DIMSNTPPPRPPKPSHLSERRQEEWSTHSGSKKPECTLVPRRISLSGLDNMRTWKADVEGQSLRHRDKRLSLNLP
  CRFSPMYPTASASIEDSYVPMSPQAGASGLGPHCSPDDYIPMNSGSISSPLPELPANLEPPPVNRDLKPQRKSRP
  PPLDLRNLSIIREHASLTRTRTVPCSRTSFLSPERNGINSARFFANPVSREDEESYIEMEEHRTASSLSSGALTW
  TKKFSLDYLALDFNSASPAPMQQKLLLSEEQRVDYVQVDEQKTQALQSTKQEWTDERQSKV

• Structural information:
  • Protein Domains: (5..11-)
    (/note="PH-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00145"-)
  • Interpro: IPR011993  IPR001849  
  • Prosite: PS50003
  • STRING: ENSP00000399588
• Other Databases: GeneCards:  GAB3  Malacards:  GAB3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0030225	macrophage differentiation	IEA	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881