• Gene id: 1396

Gene Summary

• Gene Symbol: CRIP1   Gene   UCSC   Ensembl
• Aliases: CRHP, CRIP, CRP-1, CRP1
• Gene name: cysteine rich protein 1
• Alternate names: cysteine-rich protein 1, cysteine-rich heart protein, cysteine-rich intestinal protein, cysteine-rich protein 1 (intestinal),
• Gene location: 14q32.33 (105486885: 105488946)     Exons: 5     NC_000014.9
• Gene summary(Entrez): Cysteine-rich intestinal protein (CRIP) belongs to the LIM/double zinc finger protein family, members of which include cysteine- and glycine-rich protein-1 (CSRP1; MIM 123876), rhombotin-1 (RBTN1; MIM 186921), rhombotin-2 (RBTN2; MIM 180385), and rhomboti
• OMIM: 123875

Protein Summary

• Protein general information: P50238  
  • Name: Cysteine rich protein 1 (CRP 1) (Cysteine rich heart protein) (CRHP) (hCRHP) (Cysteine rich intestinal protein) (CRIP)
  • Length: 77  
  • Mass: 8533
• Sequence:

  MPKCPKCNKEVYFAERVTSLGKDWHRPCLKCEKCGKTLTSGGHAEHEGKPYCNHPCYAAMFGPKGFGRGGAESHT
  FK

• Structural information:
  • Protein Domains: (2..6-)
    (/note="LIM-zinc-binding)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00125"-)
  • Interpro: IPR001781  
  • Prosite: PS00478 PS50023
  • STRING: ENSP00000332449
• Other Databases: GeneCards:  CRIP1  Malacards:  CRIP1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0008270	zinc ion binding	IBA	molecular function
GO:0010468	regulation of gene expression	IBA	biological process
GO:0008630	intrinsic apoptotic signaling pathway in response to DNA damage	IBA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0071236	cellular response to antibiotic	IDA	biological process
GO:0042277	peptide binding	IDA	molecular function
GO:0008630	intrinsic apoptotic signaling pathway in response to DNA damage	IDA	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:0010043	response to zinc ion	IDA	biological process
GO:0008270	zinc ion binding	IDA	molecular function
GO:0071493	cellular response to UV-B	IDA	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0010033	response to organic substance	IEP	biological process
GO:0060741	prostate gland stromal morphogenesis	IEP	biological process
GO:0010468	regulation of gene expression	IEP	biological process
GO:0007507	heart development	TAS	biological process
GO:0006955	immune response	IEP	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881