• Gene id: 1395

Gene Summary

• Gene Symbol: CRHR2   Gene   UCSC   Ensembl
• Aliases: CRF-RB, CRF2, CRFR2, HM-CRF
• Gene name: corticotropin releasing hormone receptor 2
• Alternate names: corticotropin-releasing factor receptor 2, CRF2 receptor, beta isoform, CRH receptor 2 variant B, CRH-R2,
• Gene location: 7p14.3 (30700102: 30649405)     Exons: 16     NC_000007.14
• Gene summary(Entrez): The protein encoded by this gene belongs to the G-protein coupled receptor 2 family, and the subfamily of corticotropin releasing hormone receptor. This receptor shows high affinity for corticotropin releasing hormone (CRH), and also binds CRH-related pep
• OMIM: 602494

Protein Summary

• Protein general information: Q13324  
  • Name: Corticotropin releasing factor receptor 2 (CRF R 2) (CRF R2) (CRFR 2) (Corticotropin releasing hormone receptor 2) (CRH R 2) (CRH R2)
  • Length: 411  
  • Mass: 47688
• Sequence:

  MDAALLHSLLEANCSLALAEELLLDGWGPPLDPEGPYSYCNTTLDQIGTCWPRSAAGALVERPCPEYFNGVKYNT
  TRNAYRECLENGTWASKINYSQCEPILDDKQRKYDLHYRIALVVNYLGHCVSVAALVAAFLLFLALRSIRCLRNV
  IHWNLITTFILRNVMWFLLQLVDHEVHESNEVWCRCITTIFNYFVVTNFFWMFVEGCYLHTAIVMTYSTERLRKC
  LFLFIGWCIPFPIIVAWAIGKLYYENEQCWFGKEPGDLVDYIYQGPIILVLLINFVFLFNIVRILMTKLRASTTS
  ETIQYRKAVKATLVLLPLLGITYMLFFVNPGEDDLSQIMFIYFNSFLQSFQGFFVSVFYCFFNGEVRSAVRKRWH
  RWQDHHSLRVPMARAMSIPTSPTRISFHSIKQTAAV

• Structural information:
  • Interpro: IPR017981  IPR003053  IPR003051  IPR036445  IPR001879   IPR000832  IPR017983  
  • Prosite: PS00649 PS00650 PS50227 PS50261
  • PDB: 3N93 3N95 3N96
  • PDBsum: 3N93 3N95 3N96
  • STRING: ENSP00000340943
• Other Databases: GeneCards:  CRHR2  Malacards:  CRHR2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0060291	long-term synaptic potentiation	IBA	biological process
GO:0043404	corticotropin-releasing hormone receptor activity	IBA	molecular function
GO:0030425	dendrite	IBA	cellular component
GO:0017046	peptide hormone binding	IBA	molecular function
GO:0007188	adenylate cyclase-modulating G protein-coupled receptor signaling pathway	IBA	biological process
GO:0043679	axon terminus	IBA	cellular component
GO:0015056	corticotrophin-releasing factor receptor activity	IBA	molecular function
GO:0008528	G protein-coupled peptide receptor activity	IBA	molecular function
GO:0005886	plasma membrane	IBA	cellular component
GO:0004888	transmembrane signaling receptor activity	IEA	molecular function
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0007166	cell surface receptor signaling pathway	IEA	biological process
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0007165	signal transduction	IEA	biological process
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0015056	corticotrophin-releasing factor receptor activity	TAS	molecular function
GO:0005886	plasma membrane	TAS	cellular component
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0007188	adenylate cyclase-modulating G protein-coupled receptor signaling pathway	TAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0071376	cellular response to corticotropin-releasing hormone stimulus	IEA	biological process
GO:0071376	cellular response to corticotropin-releasing hormone stimulus	IEA	biological process
GO:0009755	hormone-mediated signaling pathway	IEA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0060291	long-term synaptic potentiation	IBA	biological process
GO:0043404	corticotropin-releasing hormone receptor activity	IBA	molecular function
GO:0030425	dendrite	IBA	cellular component
GO:0017046	peptide hormone binding	IBA	molecular function
GO:0007188	adenylate cyclase-modulating G protein-coupled receptor signaling pathway	IBA	biological process
GO:0043679	axon terminus	IBA	cellular component
GO:0015056	corticotrophin-releasing factor receptor activity	IBA	molecular function
GO:0008528	G protein-coupled peptide receptor activity	IBA	molecular function
GO:0005886	plasma membrane	IBA	cellular component
GO:0004888	transmembrane signaling receptor activity	IEA	molecular function
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0007166	cell surface receptor signaling pathway	IEA	biological process
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0007165	signal transduction	IEA	biological process
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0015056	corticotrophin-releasing factor receptor activity	TAS	molecular function
GO:0005886	plasma membrane	TAS	cellular component
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0007188	adenylate cyclase-modulating G protein-coupled receptor signaling pathway	TAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0071376	cellular response to corticotropin-releasing hormone stimulus	IEA	biological process
GO:0071376	cellular response to corticotropin-releasing hormone stimulus	IEA	biological process
GO:0009755	hormone-mediated signaling pathway	IEA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04080	Neuroactive ligand-receptor interaction
hsa04934	Cushing syndrome

Diseases

Associated diseases	References
Asthma	PMID:18408560
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq