• Gene id: 139422

Gene Summary

• Gene Symbol: MAGEB10   Gene   UCSC   Ensembl
• Gene name: MAGE family member B10
• Alternate names: melanoma-associated antigen B10, MAGE family testis and tumor-specific protein, MAGE-B10 antigen, melanoma antigen family B, 10, melanoma antigen family B10,
• Gene location: Xp21.3 (88570402: 88631963)     Exons: 20     NC_000016.10
• Gene summary(Entrez): This gene encodes a member of the B subfamily of the melanoma associated antigen protein family. The encoded protein is specifically expressed in testis and tumor cells. [provided by RefSeq, Apr 2010]
• OMIM: 300761

Protein Summary

• Protein general information: Q96LZ2  
  • Name: Melanoma associated antigen B10 (MAGE B10 antigen)
  • Length: 347  
  • Mass: 38971
• Sequence:

  MPRGQKSKLRAREKRRQARGGLEDLIDALDILEEEEESPPSASACLKDVFQSSLDGASNNPHGLREAQSTSTSAT
  AASHTRHPEGVNDQMEERPICTQDLEATDSFPRGPVDEKVIILVHYLLYKYQMKEPITKADMLRNVTQMSKSQFP
  VILSRASEHLELIFGLDLKEVEPNKHIYVLVNKLDLGCDAKLSDETGVPKTGLLMTVLGIIFTNGNCVAEEEVWK
  VFNTMGLYDGIEHFMFGEPRKLLTKDLVKENYLEYQQVPNSDPPRYQFLWGPRAHAETSKMKVLEFLAKVNDTAP
  SEFSNWYTEALQDEEERARARVAAKARVSATAGARSKVKSSKSSQLQ

• Structural information:
  • Protein Domains: (111..31-)
    (/note="MAGE-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00127"-)
  • Interpro: IPR037445  IPR021072  IPR041898  IPR041899  IPR002190  
  • Prosite: PS50838
  • STRING: ENSP00000368304
• Other Databases: GeneCards:  MAGEB10  Malacards:  MAGEB10

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005515	protein binding	IPI	molecular function

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)