• Gene id: 139341

Gene Summary

• Gene Symbol: FUNDC1   Gene   UCSC   Ensembl
• Gene name: FUN14 domain containing 1
• Alternate names: FUN14 domain-containing protein 1,
• Gene location: Xp11.3 (44542858: 44523638)     Exons: 5     NC_000023.11
• Gene summary(Entrez): This gene encodes a protein with a FUN14 superfamily domain. The function of the encoded protein is not known. [provided by RefSeq, Sep 2011]
• OMIM: 300871

Protein Summary

• Protein general information: Q8IVP5  
  • Name: FUN14 domain containing protein 1
  • Length: 155  
  • Mass: 17178
  • Tissue specificity: Widely expressed. {ECO
• Sequence:

  MATRNPPPQDYESDDDSYEVLDLTEYARRHQWWNRVFGHSSGPMVEKYSVATQIVMGGVTGWCAGFLFQKVGKLA
  ATAVGGGFLLLQIASHSGYVQIDWKRVEKDVNKAKRQIKKRANKAAPEINNLIEEATEFIKQNIVISSGFVGGFL
  LGLAS

• Structural information:
  • Interpro: IPR007014  
  • PDB: 2N9X 5GMV
  • PDBsum: 2N9X 5GMV
  • STRING: ENSP00000367284
• Other Databases: GeneCards:  FUNDC1  Malacards:  FUNDC1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000422	autophagy of mitochondrion	IBA	biological process
GO:0031307	integral component of mitochondrial outer membrane	IBA	cellular component
GO:0001666	response to hypoxia	IDA	biological process
GO:0031307	integral component of mitochondrial outer membrane	IDA	cellular component
GO:0000422	autophagy of mitochondrion	IDA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0006914	autophagy	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005741	mitochondrial outer membrane	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005741	mitochondrial outer membrane	IDA	cellular component
GO:0001666	response to hypoxia	IMP	biological process
GO:0000422	autophagy of mitochondrion	IGI	biological process
GO:0000422	autophagy of mitochondrion	IMP	biological process
GO:0005741	mitochondrial outer membrane	TAS	cellular component
GO:0005741	mitochondrial outer membrane	TAS	cellular component
GO:0005741	mitochondrial outer membrane	TAS	cellular component
GO:0005741	mitochondrial outer membrane	TAS	cellular component
GO:0005741	mitochondrial outer membrane	TAS	cellular component
GO:0005741	mitochondrial outer membrane	TAS	cellular component
GO:0016236	macroautophagy	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0010243	response to organonitrogen compound	IEA	biological process
GO:0005741	mitochondrial outer membrane	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04137	Mitophagy - animal

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)