• Gene id: 1393

Gene Summary

• Gene Symbol: CRHBP   Gene   UCSC   Ensembl
• Aliases: CRF-BP, CRFBP
• Gene name: corticotropin releasing hormone binding protein
• Alternate names: corticotropin-releasing factor-binding protein, CRF-binding protein, CRH-BP,
• Gene location: 5q13.3 (76952854: 76981142)     Exons: 9     NC_000005.10
• Gene summary(Entrez): Corticotropin-releasing hormone is a potent stimulator of synthesis and secretion of preopiomelanocortin-derived peptides. Although CRH concentrations in the human peripheral circulation are normally low, they increase throughout pregnancy and fall rapidl
• OMIM: 122559

SNPs

rs2855658

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000002.12   g.38069747T>C
NC_000002.11   g.38296890T>C
NG_008386.2   g.11355A>G
NM_000104.3   c.*975A>G|SEQ=[T/C]|GENE=CYP1B1
RMDN2   151393

Protein Summary

• Protein general information: P24387  
  • Name: Corticotropin releasing factor binding protein (CRF BP) (CRF binding protein) (Corticotropin releasing hormone binding protein) (CRH BP)
  • Length: 322  
  • Mass: 36144
• Sequence:

  MSPNFKLQCHFILIFLTALRGESRYLELREAADYDPFLLFSANLKRELAGEQPYRRALRCLDMLSLQGQFTFTAD
  RPQLHCAAFFISEPEEFITIHYDQVSIDCQGGDFLKVFDGWILKGEKFPSSQDHPLPSAERYIDFCESGLSRRSI
  RSSQNVAMIFFRVHEPGNGFTLTIKTDPNLFPCNVISQTPNGKFTLVVPHQHRNCSFSIIYPVVIKISDLTLGHV
  NGLQLKKSSAGCEGIGDFVELLGGTGLDPSKMTPLADLCYPFHGPAQMKVGCDNTVVRMVSSGKHVNRVTFEYRQ
  LEPYELENPNGNSIGEFCLSGL

• Structural information:
  • Interpro: IPR008435  IPR035914  
  • STRING: ENSP00000274368
• Other Databases: GeneCards:  CRHBP  Malacards:  CRHBP

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0051424	corticotropin-releasing hormone binding	IBA	molecular function
GO:0051460	negative regulation of corticotropin secretion	IBA	biological process
GO:1900011	negative regulation of corticotropin-releasing hormone receptor activity	IBA	biological process
GO:0005615	extracellular space	IBA	cellular component
GO:0009755	hormone-mediated signaling pathway	IBA	biological process
GO:0051424	corticotropin-releasing hormone binding	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:2000310	regulation of NMDA receptor activity	IEA	biological process
GO:0051424	corticotropin-releasing hormone binding	IEA	molecular function
GO:0042445	hormone metabolic process	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0097211	cellular response to gonadotropin-releasing hormone	IEA	biological process
GO:0071392	cellular response to estradiol stimulus	IEA	biological process
GO:0071320	cellular response to cAMP	IEA	biological process
GO:0071277	cellular response to calcium ion	IEA	biological process
GO:0035690	cellular response to drug	IEA	biological process
GO:0005615	extracellular space	IEA	cellular component
GO:0002125	maternal aggressive behavior	IEA	biological process
GO:0001963	synaptic transmission, dopaminergic	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0071392	cellular response to estradiol stimulus	IDA	biological process
GO:0051459	regulation of corticotropin secretion	IDA	biological process
GO:0007565	female pregnancy	IDA	biological process
GO:0005794	Golgi apparatus	IDA	NOT|cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0051460	negative regulation of corticotropin secretion	IDA	biological process
GO:0051424	corticotropin-releasing hormone binding	IDA	molecular function
GO:0071356	cellular response to tumor necrosis factor	IDA	biological process
GO:0045055	regulated exocytosis	IDA	biological process
GO:0030141	secretory granule	IDA	cellular component
GO:0009755	hormone-mediated signaling pathway	IDA	biological process
GO:0005783	endoplasmic reticulum	IDA	NOT|cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:1900011	negative regulation of corticotropin-releasing hormone receptor activity	IDA	biological process
GO:0071391	cellular response to estrogen stimulus	IDA	biological process
GO:0035865	cellular response to potassium ion	IDA	biological process
GO:0006954	inflammatory response	IDA	biological process
GO:0031045	dense core granule	ISS	cellular component
GO:0030425	dendrite	ISS	cellular component
GO:0007565	female pregnancy	IEP	biological process
GO:0007165	signal transduction	TAS	biological process
GO:0005767	secondary lysosome	ISS	cellular component
GO:0001963	synaptic transmission, dopaminergic	ISS	biological process
GO:0043679	axon terminus	ISS	cellular component
GO:0043204	perikaryon	ISS	cellular component
GO:0043196	varicosity	ISS	cellular component
GO:0042277	peptide binding	ISS	molecular function
GO:0080135	regulation of cellular response to stress	IMP	biological process
GO:0005874	microtubule	ISS	cellular component
GO:0097211	cellular response to gonadotropin-releasing hormone	ISS	biological process
GO:0071320	cellular response to cAMP	ISS	biological process
GO:0071314	cellular response to cocaine	ISS	biological process
GO:0071277	cellular response to calcium ion	ISS	biological process
GO:0035690	cellular response to drug	ISS	biological process
GO:0007611	learning or memory	TAS	biological process
GO:0005771	multivesicular body	ISS	cellular component
GO:2000310	regulation of NMDA receptor activity	ISS	biological process
GO:0051424	corticotropin-releasing hormone binding	IPI	molecular function
GO:0048149	behavioral response to ethanol	IMP	biological process
GO:0005634	nucleus	ISS	cellular component
GO:0005515	protein binding	IPI	molecular function

Diseases

Associated diseases	References
Mental depression	PMID:14573312
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq