• Gene id: 1392

Gene Summary

• Gene Symbol: CRH   Gene   UCSC   Ensembl
• Aliases: CRF, CRH1
• Gene name: corticotropin releasing hormone
• Alternate names: corticoliberin, corticotropin-releasing factor,
• Gene location: 8q13.1 (66178463: 66176375)     Exons: 2     NC_000008.11
• Gene summary(Entrez): This gene encodes a member of the corticotropin-releasing factor family. The encoded preproprotein is proteolytically processed to generate the mature neuropeptide hormone. In response to stress, this hormone is secreted by the paraventricular nucleus (PV
• OMIM: 122560

Protein Summary

• Protein general information: P06850  
  • Name: Corticoliberin (Corticotropin releasing factor) (CRF) (Corticotropin releasing hormone)
  • Length: 196  
  • Mass: 21422
  • Tissue specificity: Produced by the hypothalamus and placenta. {ECO
• Sequence:

  MRLPLLVSAGVLLVALLPCPPCRALLSRGPVPGARQAPQHPQPLDFFQPPPQSEQPQQPQARPVLLRMGEEYFLR
  LGNLNKSPAAPLSPASSLLAGGSGSRPSPEQATANFFRVLLQQLLLPRRSLDSPAALAERGARNALGGHQEAPER
  ERRSEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEIIGK

• Structural information:
  • Interpro: IPR018446  IPR000187  IPR003620  
  • Prosite: PS00511
  • PDB: 1GO9 1GOE 3EHT 3EHU
  • PDBsum: 1GO9 1GOE 3EHT 3EHU
  • STRING: ENSP00000276571
• Other Databases: GeneCards:  CRH  Malacards:  CRH

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005615	extracellular space	IBA	cellular component
GO:0051464	positive regulation of cortisol secretion	IBA	biological process
GO:0017045	corticotropin-releasing hormone activity	IBA	molecular function
GO:0032811	negative regulation of epinephrine secretion	IBA	biological process
GO:0070093	negative regulation of glucagon secretion	IBA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0005179	hormone activity	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0005179	hormone activity	IEA	molecular function
GO:0005184	neuropeptide hormone activity	TAS	molecular function
GO:0005102	signaling receptor binding	TAS	molecular function
GO:0005179	hormone activity	TAS	molecular function
GO:0007567	parturition	TAS	biological process
GO:0007165	signal transduction	TAS	biological process
GO:0007268	chemical synaptic transmission	TAS	biological process
GO:0007565	female pregnancy	TAS	biological process
GO:0007611	learning or memory	TAS	biological process
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:2000854	positive regulation of corticosterone secretion	IEA	biological process
GO:0090280	positive regulation of calcium ion import	IEA	biological process
GO:0071314	cellular response to cocaine	IEA	biological process
GO:0060548	negative regulation of cell death	IEA	biological process
GO:0060291	long-term synaptic potentiation	IEA	biological process
GO:0051461	positive regulation of corticotropin secretion	IEA	biological process
GO:0051431	corticotropin-releasing hormone receptor 2 binding	IEA	molecular function
GO:0045472	response to ether	IEA	biological process
GO:0045471	response to ethanol	IEA	biological process
GO:0043950	positive regulation of cAMP-mediated signaling	IEA	biological process
GO:0043627	response to estrogen	IEA	biological process
GO:0035774	positive regulation of insulin secretion involved in cellular response to glucose stimulus	IEA	biological process
GO:0033685	negative regulation of luteinizing hormone secretion	IEA	biological process
GO:0021854	hypothalamus development	IEA	biological process
GO:0016101	diterpenoid metabolic process	IEA	biological process
GO:0014062	regulation of serotonin secretion	IEA	biological process
GO:0010700	negative regulation of norepinephrine secretion	IEA	biological process
GO:0010628	positive regulation of gene expression	IEA	biological process
GO:0008284	positive regulation of cell population proliferation	IEA	biological process
GO:0007611	learning or memory	IEA	biological process
GO:0005615	extracellular space	IEA	cellular component
GO:0003085	negative regulation of systemic arterial blood pressure	IEA	biological process
GO:0001963	synaptic transmission, dopaminergic	IEA	biological process
GO:0035641	locomotory exploration behavior	IEA	biological process
GO:0030325	adrenal gland development	IEA	biological process
GO:2000987	positive regulation of behavioral fear response	IEA	biological process
GO:2000310	regulation of NMDA receptor activity	IEA	biological process
GO:0071549	cellular response to dexamethasone stimulus	IEA	biological process
GO:0070093	negative regulation of glucagon secretion	IEA	biological process
GO:0060456	positive regulation of digestive system process	IEA	biological process
GO:0051430	corticotropin-releasing hormone receptor 1 binding	IEA	molecular function
GO:0051412	response to corticosterone	IEA	biological process
GO:0050801	ion homeostasis	IEA	biological process
GO:0048265	response to pain	IEA	biological process
GO:0043204	perikaryon	IEA	cellular component
GO:0043196	varicosity	IEA	cellular component
GO:0043025	neuronal cell body	IEA	cellular component
GO:0042493	response to drug	IEA	biological process
GO:0042220	response to cocaine	IEA	biological process
GO:0035902	response to immobilization stress	IEA	biological process
GO:0032811	negative regulation of epinephrine secretion	IEA	biological process
GO:0010942	positive regulation of cell death	IEA	biological process
GO:0010629	negative regulation of gene expression	IEA	biological process
GO:0008628	hormone-mediated apoptotic signaling pathway	IEA	biological process
GO:0008306	associative learning	IEA	biological process
GO:0008202	steroid metabolic process	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0001934	positive regulation of protein phosphorylation	IEA	biological process
GO:0030324	lung development	IEA	biological process
GO:0006954	inflammatory response	IEA	biological process
GO:0006704	glucocorticoid biosynthetic process	IEA	biological process
GO:0051464	positive regulation of cortisol secretion	IDA	biological process
GO:0010841	positive regulation of circadian sleep/wake cycle, wakefulness	NAS	biological process
GO:0042322	negative regulation of circadian sleep/wake cycle, REM sleep	NAS	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0045202	synapse	IEA	cellular component
GO:0045202	synapse	IEA	cellular component
GO:0045202	synapse	IEA	cellular component
GO:0007565	female pregnancy	IDA	biological process
GO:0005615	extracellular space	IDA	cellular component
GO:0001963	synaptic transmission, dopaminergic	IDA	biological process
GO:0051461	positive regulation of corticotropin secretion	IDA	biological process
GO:0006954	inflammatory response	IDA	biological process
GO:2000310	regulation of NMDA receptor activity	IDA	biological process
GO:0005515	protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04080	Neuroactive ligand-receptor interaction
hsa05034	Alcoholism
hsa04934	Cushing syndrome
hsa04730	Long-term depression

Diseases

Associated diseases	References
Alzheimer's disease	PMID:7477348
Parkinson's disease	PMID:3502064
Panic disorder	PMID:14675801
obesity	PMID:11564446
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)