• Gene id: 1389

Gene Summary

• Gene Symbol: CREBL2   Gene   UCSC   Ensembl
• Gene name: cAMP responsive element binding protein like 2
• Alternate names: cAMP-responsive element-binding protein-like 2, MHBs-binding protein 1,
• Gene location: 12p13.1 (12611875: 12645107)     Exons: 4     NC_000012.12
• Gene summary(Entrez): cAMP response element (CRE)-binding protein-like-2 (CREBL2) was identified in a search to find genes in a commonly deleted region on chromosome 12p13 flanked by ETV6 and CDKN1B genes, frequently associated with hematopoietic malignancies, as well as breas
• OMIM: 603476

Protein Summary

• Protein general information: O60519  
  • Name: cAMP responsive element binding protein like 2
  • Length: 120  
  • Mass: 13784
• Sequence:

  MDDSKVVGGKVKKPGKRGRKPAKIDLKAKLERSRQSARECRARKKLRYQYLEELVSSRERAICALREELEMYKQW
  CMAMDQGKIPSEIKALLTGEEQNKSQQNSSRHTKAGKTDANSNSW

• Structural information:
  • Protein Domains: (23..8-)
    (/note="bZIP"-)
  • Interpro: IPR004827  IPR039250  
  • STRING: ENSP00000228865
• Other Databases: GeneCards:  CREBL2  Malacards:  CREBL2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000790	nuclear chromatin	ISA	cellular component
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA	molecular function
GO:0050821	protein stabilization	ISS	biological process
GO:0045893	positive regulation of transcription, DNA-templated	ISS	biological process
GO:0045600	positive regulation of fat cell differentiation	ISS	biological process
GO:0046889	positive regulation of lipid biosynthetic process	ISS	biological process
GO:0046326	positive regulation of glucose import	ISS	biological process
GO:0033138	positive regulation of peptidyl-serine phosphorylation	ISS	biological process
GO:0005634	nucleus	ISS	cellular component
GO:0003700	DNA-binding transcription factor activity	IEA	molecular function
GO:0006355	regulation of transcription, DNA-templated	IEA	biological process
GO:0030154	cell differentiation	IEA	biological process
GO:0007049	cell cycle	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0003677	DNA binding	IEA	molecular function
GO:0003700	DNA-binding transcription factor activity	TAS	molecular function
GO:0005634	nucleus	TAS	cellular component
GO:0006351	transcription, DNA-templated	TAS	biological process
GO:0007165	signal transduction	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0006357	regulation of transcription by RNA polymerase II	IEA	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq