• Gene id: 138716

Gene Summary

• Gene Symbol: RPP25L   Gene   UCSC   Ensembl
• Aliases: C9orf23, bA296L22.5
• Gene name: ribonuclease P/MRP subunit p25 like
• Alternate names: ribonuclease P protein subunit p25-like protein, RNase P protein subunit-like p25, alba-like protein C9orf23, ribonuclease P/MRP 25kDa subunit-like, rpp25-like protein,
• Gene location: 9p13.3 (34612096: 34610494)     Exons: 2     NC_000009.12
• Gene summary(Entrez): This gene encodes a protein that appears to belong to a family of evolutionarily related proteins (DUF78), that may share one or more domains in common. Members of this family are small archaebacterial proteins with no known function. Alternative splicing

Protein Summary

• Protein general information: Q8N5L8  
  • Name: Ribonuclease P protein subunit p25 like protein (RNase P protein subunit like p25) (Rpp25 like protein)
  • Length: 163  
  • Mass: 17631
• Sequence:

  MEHYRKAGSVELPAPSPMPQLPPDTLEMRVRDGSKIRNLLGLALGRLEGGSARHVVFSGSGRAAGKAVSCAEIVK
  RRVPGLHQLTKLRFLQTEDSWVPASPDTGLDPLTVRRHVPAVWVLLSRDPLDPNECGYQPPGAPPGLGSMPSSSC
  GPRSRRRARDTRS

• Structural information:
  • Interpro: IPR036882  IPR002775  
  • STRING: ENSP00000297613
• Other Databases: GeneCards:  RPP25L  Malacards:  RPP25L

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001682	tRNA 5'-leader removal	IBA	biological process
GO:0005634	nucleus	IBA	cellular component
GO:0003723	RNA binding	IBA	molecular function
GO:0000172	ribonuclease MRP complex	IBA	cellular component
GO:0003676	nucleic acid binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0003723	RNA binding	HDA	molecular function

KEGG pathways

Pathway id	Pathway name
hsa03013	RNA transport
hsa03008	Ribosome biogenesis in eukaryotes

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881