• Gene id: 1381

Gene Summary

• Gene Symbol: CRABP1   Gene   UCSC   Ensembl
• Aliases: CRABP, CRABP-I, CRABPI, RBP5
• Gene name: cellular retinoic acid binding protein 1
• Alternate names: cellular retinoic acid-binding protein 1, cellular retinoic acid-binding protein I,
• Gene location: 15q25.1 (78340352: 78348224)     Exons: 4     NC_000015.10
• Gene summary(Entrez): This gene encodes a specific binding protein for a vitamin A family member and is thought to play an important role in retinoic acid-mediated differentiation and proliferation processes. It is structurally similar to the cellular retinol-binding proteins,
• OMIM: 601807

Protein Summary

• Protein general information: P29762  
  • Name: Cellular retinoic acid binding protein 1 (Cellular retinoic acid binding protein I) (CRABP I)
  • Length: 137  
  • Mass: 15566
• Sequence:

  MPNFAGTWKMRSSENFDELLKALGVNAMLRKVAVAAASKPHVEIRQDGDQFYIKTSTTVRTTEINFKVGEGFEEE
  TVDGRKCRSLATWENENKIHCTQTLLEGDGPKTYWTRELANDELILTFGADDVVCTRIYVRE

• Structural information:
  • Interpro: IPR012674  IPR031279  IPR000463  IPR031259  IPR000566  
  • Prosite: PS00214
  • STRING: ENSP00000299529
• Other Databases: GeneCards:  CRABP1  Malacards:  CRABP1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0008289	lipid binding	IEA	molecular function
GO:0001972	retinoic acid binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0034653	retinoic acid catabolic process	IEA	biological process
GO:0016918	retinal binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0019841	retinol binding	IEA	molecular function
GO:0005501	retinoid binding	TAS	molecular function
GO:0007275	multicellular organism development	TAS	biological process
GO:0007165	signal transduction	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005829	cytosol	IEA	cellular component
GO:0001972	retinoic acid binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray