• Gene id: 1379

Gene Summary

• Gene Symbol: CR1L   Gene   UCSC   Ensembl
• Gene name: complement C3b/C4b receptor 1 like
• Alternate names: complement component receptor 1-like protein, complement C4b-binding protein CR-1-like protein, complement component (3b/4b) receptor 1-like,
• Gene location: 1q32.2 (119071001: 119249431)     Exons: 47     NC_000005.10
• OMIM: 605886

Protein Summary

• Protein general information: Q2VPA4  
  • Name: Complement component receptor 1 like protein (Complement C4b binding protein CR 1 like protein)
  • Length: 569  
  • Mass: 62714
  • Tissue specificity: Expressed in fetal liver and to a lesser extent in fetal spleen and thymus. Expression appears to be limited to hematopoietic and fetal lymphoid tissue. {ECO
• Sequence:

  MAPPVRLERPFPSRRFPGLLLAALVLLLSSFSDQCNVPEWLPFARPTNLTDDFEFPIGTYLNYECRPGYSGRPFS
  IICLKNSVWTSAKDKCKRKSCRNPPDPVNGMAHVIKDIQFRSQIKYSCPKGYRLIGSSSATCIISGNTVIWDNKT
  PVCDRIICGLPPTIANGDFTSISREYFHYGSVVTYHCNLGSRGKKVFELVGEPSIYCTSKDDQVGIWSGPAPQCI
  IPNKCTPPNVENGILVSDNRSLFSLNEVVEFRCQPGFGMKGPSHVKCQALNKWEPELPSCSRVCQPPPDVLHAER
  TQRDKDNFSPGQEVFYSCEPGYDLRGSTYLHCTPQGDWSPAAPRCEVKSCDDFLGQLPNGHVLFPLNLQLGAKVD
  FVCDEGFQLKGSSASYCVLAGMESLWNSSVPVCERKSCETPPVPVNGMVHVITDIHVGSRINYSCTTGHRLIGHS
  SAECILSGNTAHWSMKPPICQQIFCPNPPAILNGRHTGTPLGDIPYGKEVSYTCDPHPDRGMTFNLIGESTIRRT
  SEPHGNGVWSSPAPRCELPVGAGSHDALIVGKFYEVFAEEFCHL

• Structural information:
  • Protein Domains: (33..9-)
    (/note="Sushi-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00302-)
    (94..15-)
    (/note="Sushi-2)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00302-)
    (156..22-)
    (/note="Sushi-3)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00302-)
    (-)
  • Interpro: IPR035976  IPR000436  
  • Prosite: PS50923
  • CDD: cd00033
  • STRING: ENSP00000421736
• Other Databases: GeneCards:  CR1L  Malacards:  CR1L

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005576	extracellular region	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0043235	receptor complex	IDA	cellular component
GO:0030449	regulation of complement activation	IDA	biological process
GO:1903659	regulation of complement-dependent cytotoxicity	IDA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0016020	membrane	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa05152	Tuberculosis
hsa04640	Hematopoietic cell lineage
hsa04610	Complement and coagulation cascades
hsa05140	Leishmaniasis
hsa05134	Legionellosis
hsa05144	Malaria

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)