• Gene id: 137886

Gene Summary

• Gene Symbol: UBXN2B   Gene   UCSC   Ensembl
• Aliases: p37
• Gene name: UBX domain protein 2B
• Alternate names: UBX domain-containing protein 2B, NSFL1 cofactor p37, p97 cofactor p37,
• Gene location: 8q12.1 (58411263: 58451500)     Exons: 9     NC_000008.11
• OMIM: 102681

Protein Summary

• Protein general information: Q14CS0  
  • Name: UBX domain containing protein 2B (NSFL1 cofactor p37) (p97 cofactor p37)
  • Length: 331  
  • Mass: 37077
• Sequence:

  MAEGGGPEPGEQERRSSGPRPPSARDLQLALAELYEDEVKCKSSKSNRPKATVFKSPRTPPQRFYSSEHEYSGLN
  IVRPSTGKIVNELFKEAREHGAVPLNEATRASGDDKSKSFTGGGYRLGSSFCKRSEYIYGENQLQDVQILLKLWS
  NGFSLDDGELRPYNEPTNAQFLESVKRGEIPLELQRLVHGGQVNLDMEDHQDQEYIKPRLRFKAFSGEGQKLGSL
  TPEIVSTPSSPEEEDKSILNAVVLIDDSVPTTKIQIRLADGSRLIQRFNSTHRILDVRNFIVQSRPEFAALDFIL
  VTSFPNKELTDESLTLLEADILNTVLLQQLK

• Structural information:
  • Protein Domains: (141..20-)
    (/note="SEP-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00732-)
    (252..32-)
    (/note="UBX-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00215"-)
  • Interpro: IPR036241  IPR012989  IPR029071  IPR001012  
  • Prosite: PS51399 PS50033
  • STRING: ENSP00000382507
• Other Databases: GeneCards:  UBXN2B  Malacards:  UBXN2B

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0061025	membrane fusion	IBA	biological process
GO:0005829	cytosol	IBA	cellular component
GO:0043161	proteasome-mediated ubiquitin-dependent protein catabolic process	IBA	biological process
GO:0043130	ubiquitin binding	IBA	molecular function
GO:0031468	nuclear envelope reassembly	IBA	biological process
GO:0007030	Golgi organization	IBA	biological process
GO:0005634	nucleus	IBA	cellular component
GO:0000045	autophagosome assembly	IBA	biological process
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0031616	spindle pole centrosome	IEA	cellular component
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0005829	cytosol	IEA	cellular component
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005815	microtubule organizing center	IEA	cellular component
GO:0000132	establishment of mitotic spindle orientation	IGI	biological process
GO:0046604	positive regulation of mitotic centrosome separation	IGI	biological process
GO:1904780	negative regulation of protein localization to centrosome	IGI	biological process

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)