• Gene id: 137868

Gene Summary

• Gene Symbol: SGCZ   Gene   UCSC   Ensembl
• Aliases: ZSG1
• Gene name: sarcoglycan zeta
• Alternate names: zeta-sarcoglycan, zeta-SG,
• Gene location: 8p22 (15238430: 14084844)     Exons: 8     NC_000008.11
• Gene summary(Entrez): The zeta-sarcoglycan gene measures over 465 kb and localizes to 8p22. This protein is part of the sarcoglycan complex, a group of 6 proteins. The sarcoglycans are all N-glycosylated transmembrane proteins with a short intra-cellular domain, a single trans
• OMIM: 614648

Protein Summary

• Protein general information: Q96LD1  
  • Name: Zeta sarcoglycan (Zeta SG) (ZSG1)
  • Length: 299  
  • Mass: 32949
• Sequence:

  MTREQYILATQQNNLPRTENAQLYPVGIYGWRKRCLYFFVLLLLVTMIVNLAMTIWILKVMNFTVDGMGNLRVTK
  KGIRLEGISEFLLPLYVKEIHSRKDSPLVLQSDRNVTVNARNHMGQLTGQLTIGADAVEAQCKRFEVRASEDGRV
  LFSADEDEITIGAEKLKVTGTEGAVFGHSVETPHIRAEPSQDLRLESPTRSLIMEAPRGVQVSAAAGDFKATCRK
  ELHLQSTEGEIFLNAETIKLGNLPTGSFSSSSPSSSSSRQTVYELCVCPNGKLYLSPAGVGSTCQSSSNICLWS

• Structural information:
  • Interpro: IPR006875  IPR039972  IPR027662  
  • STRING: ENSP00000371512
• Other Databases: GeneCards:  SGCZ  Malacards:  SGCZ

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0016012	sarcoglycan complex	IBA	cellular component
GO:0060047	heart contraction	IBA	biological process
GO:0048738	cardiac muscle tissue development	IBA	biological process
GO:0042383	sarcolemma	IBA	cellular component
GO:0016012	sarcoglycan complex	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016012	sarcoglycan complex	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0016012	sarcoglycan complex	TAS	cellular component
GO:0046716	muscle cell cellular homeostasis	TAS	biological process
GO:0061024	membrane organization	TAS	biological process
GO:0055001	muscle cell development	TAS	biological process
GO:0005856	cytoskeleton	IEA	cellular component
GO:0042383	sarcolemma	IEA	cellular component

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq