• Gene id: 137392

Gene Summary

• Gene Symbol: CIBAR1   Gene   UCSC   Ensembl
• Aliases: FAM92A, FAM92A1, PAPA9
• Gene name: CBY1 interacting BAR domain containing 1
• Alternate names: protein FAM92A, family with sequence similarity 92 member A, family with sequence similarity 92 member A1, protein FAM92A1,
• Gene location: 8q22.1 (93700549: 93731526)     Exons: 15     NC_000008.11
• OMIM: 617273

Protein Summary

• Protein general information: A1XBS5  
  • Name: Protein FAM92A
  • Length: 289  
  • Mass: 33431
• Sequence:

  MMRRTLENRNAQTKQLQTAVSNVEKHFGELCQIFAAYVRKTARLRDKADLLVNEINAYAATETPHLKLGLMNFAD
  EFAKLQDYRQAEVERLEAKVVEPLKTYGTIVKMKRDDLKATLTARNREAKQLTQLERTRQRNPSDRHVISQAETE
  LQRAAMDASRTSRHLEETINNFERQKMKDIKTIFSEFITIEMLFHGKALEVYTAAYQNIQNIDEDEDLEVFRNSL
  YAPDYSSRLDIVRANSKSPLQRSLSAKCVSGTGQVSTCRLRKDQQAEDDEDDELDVTEEENFLK

• Structural information:
  • Interpro: IPR027267  IPR035590  IPR009602  
  • CDD: cd07598
  • STRING: ENSP00000429367
• Other Databases: GeneCards:  CIBAR1  Malacards:  CIBAR1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005737	cytoplasm	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0097546	ciliary base	IDA	cellular component
GO:0061024	membrane organization	IDA	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:0005814	centriole	IDA	cellular component
GO:0005743	mitochondrial inner membrane	IDA	cellular component
GO:0005543	phospholipid binding	IDA	molecular function
GO:0035108	limb morphogenesis	IMP	biological process
GO:0060271	cilium assembly	IMP	biological process
GO:0007007	inner mitochondrial membrane organization	IMP	biological process
GO:0035869	ciliary transition zone	ISS	cellular component
GO:0060271	cilium assembly	ISS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0045880	positive regulation of smoothened signaling pathway	ISS	biological process
GO:0030030	cell projection organization	IEA	biological process
GO:0042995	cell projection	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0045880	positive regulation of smoothened signaling pathway	IEA	biological process
GO:0035108	limb morphogenesis	IEA	biological process
GO:0005929	cilium	IEA	cellular component
GO:0060271	cilium assembly	IEA	biological process
GO:0036064	ciliary basal body	IEA	cellular component
GO:0035869	ciliary transition zone	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005814	centriole	IEA	cellular component
GO:0005929	cilium	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component

Diseases

Associated diseases	References
Postaxial polydactyly	KEGG:H01852
Postaxial polydactyly	KEGG:H01852
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)