• Gene id: 1369

Gene Summary

• Gene Symbol: CPN1   Gene   UCSC   Ensembl
• Aliases: CPN, SCPN
• Gene name: carboxypeptidase N subunit 1
• Alternate names: carboxypeptidase N catalytic chain, anaphylatoxin inactivator, arginine carboxypeptidase, carboxypeptidase K, carboxypeptidase N catalytic subunit, carboxypeptidase N polypeptide 1 50 kD, carboxypeptidase N small subunit, carboxypeptidase N, polypeptide 1,
• Gene location: 10q24.2 (100081884: 100042307)     Exons: 9     NC_000010.11
• Gene summary(Entrez): Carboxypeptidase N is a plasma metallo-protease that cleaves basic amino acids from the C terminal of peptides and proteins. The enzyme is important in the regulation of peptides like kinins and anaphylatoxins, and has also been known as kininase-1 and an
• OMIM: 603103

Protein Summary

• Protein general information: P15169  
  • Name: Carboxypeptidase N catalytic chain (CPN) (EC 3.4.17.3) (Anaphylatoxin inactivator) (Arginine carboxypeptidase) (Carboxypeptidase N polypeptide 1) (Carboxypeptidase N small subunit) (Kininase 1) (Lysine carboxypeptidase) (Plasma carboxypeptidase B) (Serum
  • Length: 458  
  • Mass: 52,286
• Sequence:

  MSDLLSVFLHLLLLFKLVAPVTFRHHRYDDLVRTLYKVQNECPGITRVYSIGRSVEGRHLYVLEFSDHPGIHEPL
  EPEVKYVGNMHGNEALGRELMLQLSEFLCEEFRNRNQRIVQLIQDTRIHILPSMNPDGYEVAAAQGPNKPGYLVG
  RNNANGVDLNRNFPDLNTYIYYNEKYGGPNHHLPLPDNWKSQVEPETRAVIRWMHSFNFVLSANLHGGAVVANYP
  YDKSFEHRVRGVRRTASTPTPDDKLFQKLAKVYSYAHGWMFQGWNCGDYFPDGITNGASWYSLSKGMQDFNYLHT
  NCFEITLELSCDKFPPEEELQREWLGNREALIQFLEQVHQGIKGMVLDENYNNLANAVISVSGINHDVTSGDHGD
  YFRLLLPGIYTVSATAPGYDPETVTVTVGPAEPTLVNFHLKRSIPQVSPVRRAPSRRHGVRAKVQPQARKKEMEM
  RQLQRGPA

• Structural information:
  • Interpro: IPR008969  IPR000834  
  • Prosite: PS00132 PS00133
  • PDB: 2NSM
  • PDBsum: 2NSM
  • STRING: ENSP00000359446
• Other Databases: GeneCards:  CPN1  Malacards:  CPN1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004181	metallocarboxypeptidase activity	IEA	molecular function
GO:0004185	serine-type carboxypeptidase activity	IBA	molecular function
GO:0005615	extracellular space	IEA	cellular component
GO:0006518	peptide metabolic process	IBA	biological process
GO:0008270	zinc ion binding	IEA	molecular function
GO:0010815	bradykinin catabolic process	IEA	biological process
GO:0016485	protein processing	IBA	biological process
GO:0051384	response to glucocorticoid	IEA	biological process
GO:0004180	carboxypeptidase activity	IEA	molecular function
GO:0004180	carboxypeptidase activity	IEA	molecular function
GO:0004180	carboxypeptidase activity	IEA	molecular function
GO:0004181	metallocarboxypeptidase activity	IEA	molecular function
GO:0004181	metallocarboxypeptidase activity	TAS	molecular function
GO:0004185	serine-type carboxypeptidase activity	IBA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0005615	extracellular space	IEA	cellular component
GO:0005615	extracellular space	IEA	cellular component
GO:0005615	extracellular space	IEA	cellular component
GO:0005615	extracellular space	TAS	cellular component
GO:0006508	proteolysis	IEA	biological process
GO:0006508	proteolysis	IEA	biological process
GO:0006508	proteolysis	IEA	biological process
GO:0006518	peptide metabolic process	IBA	biological process
GO:0008233	peptidase activity	IEA	molecular function
GO:0008237	metallopeptidase activity	IEA	molecular function
GO:0008270	zinc ion binding	IEA	molecular function
GO:0010815	bradykinin catabolic process	IEA	biological process
GO:0016485	protein processing	IBA	biological process
GO:0016787	hydrolase activity	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0051384	response to glucocorticoid	IEA	biological process
GO:0004181	metallocarboxypeptidase activity	TAS	molecular function
GO:0004185	serine-type carboxypeptidase activity	IBA	molecular function
GO:0005615	extracellular space	TAS	cellular component
GO:0006518	peptide metabolic process	IBA	biological process
GO:0016485	protein processing	IBA	biological process

Diseases

Associated diseases	References
Fatty liver	GAD: 20648472
Carboxypeptidase N deficiency	OMIM: 603103
Alzheimer's disease	GAD: 16385451
Male factor infertility	MIK: 315218
Oligozoospermia	MIK: 315218
Oligozoospermia	MIK: 315218
Male infertility	MIK: 315218
Oligozoospermia	MIK: 315218
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
315218	Male infertility, Oligozoospermia				Male infertility	Kininase
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray