• Gene id: 1368

Gene Summary

• Gene Symbol: CPM   Gene   UCSC   Ensembl
• Gene name: carboxypeptidase M
• Alternate names: carboxypeptidase M, renal carboxypeptidase, urinary carboxypeptidase B,
• Gene location: 12q15 (68963239: 68842192)     Exons: 11     NC_000012.12
• Gene summary(Entrez): The protein encoded by this gene is a membrane-bound arginine/lysine carboxypeptidase. Its expression is associated with monocyte to macrophage differentiation. This encoded protein contains hydrophobic regions at the amino and carboxy termini and has 6 p
• OMIM: 114860

Protein Summary

• Protein general information: P14384  
  • Name: Carboxypeptidase M (CPM) (EC 3.4.17.12)
  • Length: 443  
  • Mass: 50514
• Sequence:

  MDFPCLWLGLLLPLVAALDFNYHRQEGMEAFLKTVAQNYSSVTHLHSIGKSVKGRNLWVLVVGRFPKEHRIGIPE
  FKYVANMHGDETVGRELLLHLIDYLVTSDGKDPEITNLINSTRIHIMPSMNPDGFEAVKKPDCYYSIGRENYNQY
  DLNRNFPDAFEYNNVSRQPETVAVMKWLKTETFVLSANLHGGALVASYPFDNGVQATGALYSRSLTPDDDVFQYL
  AHTYASRNPNMKKGDECKNKMNFPNGVTNGYSWYPLQGGMQDYNYIWAQCFEITLELSCCKYPREEKLPSFWNNN
  KASLIEYIKQVHLGVKGQVFDQNGNPLPNVIVEVQDRKHICPYRTNKYGEYYLLLLPGSYIINVTVPGHDPHITK
  VIIPEKSQNFSALKKDILLPFQGQLDSIPVSNPSCPMIPLYRNLPDHSAATKPSLFLFLVSLLHIFFK

• Structural information:
  • Interpro: IPR008969  IPR000834  
  • Prosite: PS00132 PS00133
  • PDB: 1UWY
  • PDBsum: 1UWY
  • STRING: ENSP00000448517
• Other Databases: GeneCards:  CPM  Malacards:  CPM

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0016485	protein processing	IBA	biological process
GO:0006518	peptide metabolic process	IBA	biological process
GO:0005615	extracellular space	IBA	cellular component
GO:0004181	metallocarboxypeptidase activity	IBA	molecular function
GO:0004181	metallocarboxypeptidase activity	IEA	molecular function
GO:0006508	proteolysis	IEA	biological process
GO:0008270	zinc ion binding	IEA	molecular function
GO:0008233	peptidase activity	IEA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0004180	carboxypeptidase activity	IEA	molecular function
GO:0006508	proteolysis	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0031225	anchored component of membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0008237	metallopeptidase activity	IEA	molecular function
GO:0004180	carboxypeptidase activity	TAS	molecular function
GO:0004181	metallocarboxypeptidase activity	TAS	molecular function
GO:0005886	plasma membrane	TAS	cellular component
GO:0009653	anatomical structure morphogenesis	TAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0009986	cell surface	HDA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Male factor infertility	MIK: 29961538
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
29961538	Male factor infertility			318 (128 couples presenting with OAT (MF) and 118 maternal age-matched control (no MF) subjects undergoing infertility treatment, 72 surplus cryopreserved blastocysts)	Male infertility	RNA-seq