• Gene id: 136647

Gene Summary

• Gene Symbol: MPLKIP   Gene   UCSC   Ensembl
• Aliases: ABHS, C7orf11, ORF20, TTD4
• Gene name: M-phase specific PLK1 interacting protein
• Alternate names: M-phase-specific PLK1-interacting protein, Russell-Silver syndrome region, TTD non-photosensitive 1 protein,
• Gene location: 7p14.1 (40134621: 40126026)     Exons: 2     NC_000007.14
• Gene summary(Entrez): The protein encoded by this gene localizes to the centrosome during mitosis and to the midbody during cytokinesis. The protein is phosphorylated by cyclin-dependent kinase 1 during mitosis and subsequently interacts with polo-like kinase 1. The protein is

Protein Summary

• Protein general information: Q8TAP9  
  • Name: M phase specific PLK1 interacting protein (TTD non photosensitive 1 protein)
  • Length: 179  
  • Mass: 19147
  • Tissue specificity: Expressed at highest levels in liver and kidney; intermediate expression in skeletal muscle, pancreas, heart and placenta; low expression in brain and lung. Expressed in epidermis and hair follicles. {ECO
• Sequence:

  MQRQNFRPPTPPYPGPGGGGWGSGSSFRGTPGGGGPRPPSPRDGYGSPHHTPPYGPRSRPYGSSHSPRHGGSFPG
  GRFGSPSPGGYPGSYSRSPAGSQQQFGYSPGQQQTHPQGSPRTSTPFGSGRVREKRMSNELENYFKPSMLEDPWA
  GLEPVSVVDISQQYSNTQTFTGKKGRYFC

• Structural information:
  • Interpro: IPR026618  IPR028265  
  • STRING: ENSP00000304553
• Other Databases: GeneCards:  MPLKIP  Malacards:  MPLKIP

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0051301	cell division	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0007049	cell cycle	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005815	microtubule organizing center	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0043231	intracellular membrane-bounded organelle	IDA	cellular component
GO:0005794	Golgi apparatus	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0030496	midbody	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005813	centrosome	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function

Diseases

Associated diseases	References
Trichothiodystrophy	KEGG:H00866
Trichothiodystrophy	KEGG:H00866
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq