Search Result
Gene id | 136371 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Gene Summary Protein Summary Gene ontology Diseases PubMed | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Gene Summary |
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Gene Symbol | ASB10 Gene UCSC Ensembl | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Aliases | GLC1F | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Gene name | ankyrin repeat and SOCS box containing 10 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Alternate names | ankyrin repeat and SOCS box protein 10, | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Gene location |
7q36.1 (151187791: 151175697) Exons: 7 NC_000007.14 |
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Gene summary(Entrez) |
The protein encoded by this gene is a member of the ankyrin repeat and SOCS box-containing (ASB) family of proteins. The SOCS box serves to couple suppressor of cytokine signaling (SOCS) proteins and their binding partners with the elongin B and C complex |
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
OMIM | 602909 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Protein Summary |
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Protein general information | Q8WXI3 Name: Ankyrin repeat and SOCS box protein 10 (ASB 10) Length: 467 Mass: 50894 Tissue specificity: Expressed in the eye. The highest expression is observed in the iris, with moderate levels in the trabecular meshwork (TM), the lamina, and the optic nerve; slightly lower levels in the ciliary body, retina, and choroid; and very low l | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sequence |
MLMSWSPEECKGQGEPLDDRHPLCARLVEKPSRGSEEHLKSGPGPIVTRTASGPALAFWQAVLAGDVGCVSRILA DSSTGLAPDSVFDTSDPERWRDFRFNIRALRLWSLTYEEELTTPLHVAASRGHTEVLRLLLRRRARPDSAPGGRT ALHEACAAGHTACVHVLLVAGADPNIADQDGKRPLHLCRGPGTLECAELLLRFGARVDGRSEEEEETPLHVAARL GHVELADLLLRRGACPDARNAEGWTPLLAACDVRCQSITDAEATTARCLQLCSLLLSAGADADAADQDKQRPLHL ACRRGHAAVVELLLSCGVSANTMDYGGHTPLHCALQGPAAALAQSPEHVVRALLNHGAVRVWPGALPKVLERWST CPRTIEVLMNTYSVVQLPEEAVGLVTPETLQKHQRFYSSLFALVRQPRSLQHLSRCALRSHLEGSLPQALPRLPL PPRLLRYLQLDFEGVLY | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Structural information |
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Other Databases | GeneCards: ASB10 Malacards: ASB10 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Gene ontologyExpand All | Collapse All |
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Diseases
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
PubMed referencesExpand All | Collapse All |
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|