• Gene id: 1363

Gene Summary

• Gene Symbol: CPE   Gene   UCSC   Ensembl
• Aliases: CPH
• Gene name: carboxypeptidase E
• Alternate names: carboxypeptidase E, carboxypeptidase H, cobalt-stimulated chromaffin granule carboxypeptidase, enkephalin convertase, epididymis secretory sperm binding protein, insulin granule-associated carboxypeptidase, prohormone-processing carboxypeptidase,
• Gene location: 4q32.3 (165379007: 165498546)     Exons: 9     NC_000004.12
• Gene summary(Entrez): This gene encodes a member of the M14 family of metallocarboxypeptidases. The encoded preproprotein is proteolytically processed to generate the mature peptidase. This peripheral membrane protein cleaves C-terminal amino acid residues and is involved in t

Protein Summary

• Protein general information: P16870  
  • Name: Carboxypeptidase E (CPE) (EC 3.4.17.10) (Carboxypeptidase H) (CPH) (Enkephalin convertase) (Prohormone processing carboxypeptidase)
  • Length: 476  
  • Mass: 53151
  • Tissue specificity: Isoform 2, but not isoform 1, is overexpressed in hepatocellular carcinoma (at protein level), as well as in other tumors, including pheochromocytomas and paragangliomas. {ECO
• Sequence:

  MAGRGGSALLALCGALAACGWLLGAEAQEPGAPAAGMRRRRRLQQEDGISFEYHRYPELREALVSVWLQCTAISR
  IYTVGRSFEGRELLVIELSDNPGVHEPGEPEFKYIGNMHGNEAVGRELLIFLAQYLCNEYQKGNETIVNLIHSTR
  IHIMPSLNPDGFEKAASQPGELKDWFVGRSNAQGIDLNRNFPDLDRIVYVNEKEGGPNNHLLKNMKKIVDQNTKL
  APETKAVIHWIMDIPFVLSANLHGGDLVANYPYDETRSGSAHEYSSSPDDAIFQSLARAYSSFNPAMSDPNRPPC
  RKNDDDSSFVDGTTNGGAWYSVPGGMQDFNYLSSNCFEITVELSCEKFPPEETLKTYWEDNKNSLISYLEQIHRG
  VKGFVRDLQGNPIANATISVEGIDHDVTSAKDGDYWRLLIPGNYKLTASAPGYLAITKKVAVPYSPAAGVDFELE
  SFSERKEEEKEELMEWWKMMSETLNF

• Structural information:
  • Interpro: IPR008969  IPR000834  
  • Prosite: PS00132 PS00133
  • STRING: ENSP00000386104
• Other Databases: GeneCards:  CPE  Malacards:  CPE

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0016055	Wnt signaling pathway	IDA	biological process
GO:0016485	protein processing	IBA	biological process
GO:0006518	peptide metabolic process	IBA	biological process
GO:0005615	extracellular space	IBA	cellular component
GO:0004181	metallocarboxypeptidase activity	IBA	molecular function
GO:0004181	metallocarboxypeptidase activity	IEA	molecular function
GO:0006508	proteolysis	IEA	biological process
GO:0008270	zinc ion binding	IEA	molecular function
GO:0006508	proteolysis	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0004180	carboxypeptidase activity	IEA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0008233	peptidase activity	IEA	molecular function
GO:0031410	cytoplasmic vesicle	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0008237	metallopeptidase activity	IEA	molecular function
GO:0004180	carboxypeptidase activity	TAS	molecular function
GO:0005886	plasma membrane	TAS	cellular component
GO:0033366	protein localization to secretory granule	IEA	biological process
GO:0030667	secretory granule membrane	IEA	cellular component
GO:0030072	peptide hormone secretion	IEA	biological process
GO:0030070	insulin processing	IEA	biological process
GO:0004180	carboxypeptidase activity	IEA	molecular function
GO:0042043	neurexin family protein binding	IPI	molecular function
GO:0050839	cell adhesion molecule binding	IPI	molecular function
GO:0005794	Golgi apparatus	IDA	cellular component
GO:0072657	protein localization to membrane	IDA	biological process
GO:0003214	cardiac left ventricle morphogenesis	IMP	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0030133	transport vesicle	IEA	cellular component
GO:0030658	transport vesicle membrane	IEA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0007218	neuropeptide signaling pathway	NAS	biological process
GO:0006464	cellular protein modification process	NAS	biological process

KEGG pathways

Pathway id	Pathway name
hsa04940	Type I diabetes mellitus
P06959	CCKR signaling map

Diseases

Associated diseases	References
morbid obesity	PMID:12530526
type 2 diabetes mellitus	PMID:11462236
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881