Gene id |
135927 |
Gene Summary Protein Summary Gene ontology Diseases PubMed |
Gene Summary
|
Gene Symbol |
LLCFC1 Gene UCSC Ensembl |
Aliases |
C7orf34, ctm-1 |
Gene name |
LLLL and CFNLAS motif containing 1 |
Alternate names |
LLLL and CFNLAS motif-containing protein 1, MSSP-binding protein CTM-1, uncharacterized protein C7orf34, |
Gene location |
7q34 (66052360: 66069307) Exons: 22 NC_000011.10
|
Protein Summary
|
Protein general information
| Q96L11
Name: LLLL and CFNLAS motif containing protein 1 (MSSP binding protein CTM 1)
Length: 122 Mass: 13527
|
Sequence |
MPPLAPQLCRAVFLVPILLLLQVKPLNGSPGPKDGSQTEKTPSADQNQEQFEEHFVASSVGEMWQVVDMAQQEED QSSKTAAVHKHSFHLSFCFSLASVMVFSGGPLRRTFPNIQLCFMLTH
|
Structural information |
|
Other Databases |
GeneCards: LLCFC1  Malacards: LLCFC1 |
|
GO accession | Term name | Evidence code | Go category |
---|
GO:0005576 |
extracellular region
|
IEA |
cellular component |
GO:0005576 |
extracellular region
|
IEA |
cellular component |
|
|
Associated diseases |
References |
Aberrant CpGs in Low Motility Sperm | MIK: 21674046 |
Cryptorchidism | MIK: 28606200 |
Non obstructive azoospermia | MIK: 24012201 |
Sertoli cell only syndrome | MIK: 23869807 |
Spermatogenic defects | MIK: 31037746 |
Spermatogenic defects | MIK: 31037746 |
Teratozoospermia | MIK: 17327269 |
|
|
PMID |
Condition |
Mutation |
Ethnicity |
Population details |
Infertility_type |
Associated_genes |
Abstract |
17327269 |
Teratozoos permia
|
|
|
13 (5 controls, 8 cases)
|
Male infertility |
GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
|
Show abstract |
24012201 |
Non obstru ctive azoo spermia
|
|
|
31 (4 controls, 27 cases)
|
Male infertility |
GSE45885 analyzed by GEO2R (cutoff 1.5 fold)
|
Show abstract |
23869807 |
Non obstru ctive azoo spermia, S ertoli cel l only syn drome
|
|
|
20 (4 controls, 16 cases)
|
Male infertility |
GSE45887 analyzed by GEO2R (cutoff 1.5 fold)
|
Show abstract |
21674046 |
Aberrant C pGs in Low Motility Sperm
|
|
|
18
|
Male infertility |
GSE26881
|
Show abstract |
28606200 |
Cryptorchi dism
|
|
|
Monozgotic twin s (1 control, I cwith cryptorc hidism)
|
Male infertility |
MeDIP-Seq
|
Show abstract |
31037746 |
Spermatoge nic defect s
|
|
|
28 men with az oospermia
|
Male infertility |
Microarray
|
Show abstract |
31037746 |
Spermatoge nic defect s
|
|
|
16 (1 control, 15 cases)
|
Male infertility |
GSE6023 analyzed using GEO2R
|
Show abstract |
|