About Us

Search Result


Gene id 135927
Gene Summary    Protein Summary    Gene ontology    Diseases    PubMed    

Gene Summary

Gene Symbol LLCFC1   Gene   UCSC   Ensembl
Aliases C7orf34, ctm-1
Gene name LLLL and CFNLAS motif containing 1
Alternate names LLLL and CFNLAS motif-containing protein 1, MSSP-binding protein CTM-1, uncharacterized protein C7orf34,
Gene location 7q34 (66052360: 66069307)     Exons: 22     NC_000011.10

Protein Summary

Protein general information Q96L11  

Name: LLLL and CFNLAS motif containing protein 1 (MSSP binding protein CTM 1)

Length: 122  Mass: 13527

Sequence MPPLAPQLCRAVFLVPILLLLQVKPLNGSPGPKDGSQTEKTPSADQNQEQFEEHFVASSVGEMWQVVDMAQQEED
QSSKTAAVHKHSFHLSFCFSLASVMVFSGGPLRRTFPNIQLCFMLTH
Structural information
Interpro:  IPR031684  
STRING:   ENSP00000386450
Other Databases GeneCards:  LLCFC1  Malacards:  LLCFC1

Gene ontology

Expand All | Collapse All

GO accessionTerm nameEvidence codeGo category
GO:0005576 extracellular region
IEA cellular component
GO:0005576 extracellular region
IEA cellular component
Associated diseases References
Aberrant CpGs in Low Motility Sperm MIK: 21674046
Cryptorchidism MIK: 28606200
Non obstructive azoospermia MIK: 24012201
Sertoli cell only syndrome MIK: 23869807
Spermatogenic defects MIK: 31037746
Spermatogenic defects MIK: 31037746
Teratozoospermia MIK: 17327269

PubMed references

Expand All | Collapse All

PMID Condition Mutation Ethnicity Population details Infertility_type Associated_genes Abstract
17327269 Teratozoos
permia

13 (5 controls,
8 cases)
Male infertility GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
Show abstract
24012201 Non obstru
ctive azoo
spermia

31 (4 controls,
27 cases)
Male infertility GSE45885 analyzed by GEO2R (cutoff 1.5 fold)
Show abstract
23869807 Non obstru
ctive azoo
spermia, S
ertoli cel
l only syn
drome

20 (4 controls,
16 cases)
Male infertility GSE45887 analyzed by GEO2R (cutoff 1.5 fold)
Show abstract
21674046 Aberrant C
pGs in Low
Motility
Sperm

18
Male infertility GSE26881
Show abstract
28606200 Cryptorchi
dism

Monozgotic twin
s (1 control, I
cwith cryptorc
hidism)
Male infertility MeDIP-Seq
Show abstract
31037746 Spermatoge
nic defect
s

28 men with az
oospermia
Male infertility Microarray
Show abstract
31037746 Spermatoge
nic defect
s

16 (1 control,
15 cases)
Male infertility GSE6023 analyzed using GEO2R
Show abstract