• Gene id: 1359

Gene Summary

• Gene Symbol: CPA3   Gene   UCSC   Ensembl
• Aliases: MC-CPA
• Gene name: carboxypeptidase A3
• Alternate names: mast cell carboxypeptidase A, carboxypeptidase A3 (mast cell), tissue carboxypeptidase A,
• Gene location: 3q24 (148865295: 148897202)     Exons: 18     NC_000003.12
• Gene summary(Entrez): This gene encodes a member of the carboxypeptidase A family of zinc metalloproteases. The encoded preproprotein is proteolytically processed to generate a mature protease that is released by mast cells and may be involved in the degradation of endogenous
• OMIM: 114851

Protein Summary

• Protein general information: P15088  
  • Name: Mast cell carboxypeptidase A (MC CPA) (EC 3.4.17.1) (Carboxypeptidase A3)
  • Length: 417  
  • Mass: 48670
• Sequence:

  MRLILPVGLIATTLAIAPVRFDREKVFRVKPQDEKQADIIKDLAKTNELDFWYPGATHHVAANMMVDFRVSEKES
  QAIQSALDQNKMHYEILIHDLQEEIEKQFDVKEDIPGRHSYAKYNNWEKIVAWTEKMMDKYPEMVSRIKIGSTVE
  DNPLYVLKIGEKNERRKAIFTDCGIHAREWVSPAFCQWFVYQATKTYGRNKIMTKLLDRMNFYILPVFNVDGYIW
  SWTKNRMWRKNRSKNQNSKCIGTDLNRNFNASWNSIPNTNDPCADNYRGSAPESEKETKAVTNFIRSHLNEIKVY
  ITFHSYSQMLLFPYGYTSKLPPNHEDLAKVAKIGTDVLSTRYETRYIYGPIESTIYPISGSSLDWAYDLGIKHTF
  AFELRDKGKFGFLLPESRIKPTCRETMLAVKFIAKYILKHTS

• Structural information:
  • Interpro: IPR036990  IPR003146  IPR000834  
  • Prosite: PS00133
  • STRING: ENSP00000296046
• Other Databases: GeneCards:  CPA3  Malacards:  CPA3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004181	metallocarboxypeptidase activity	IBA	molecular function
GO:0005615	extracellular space	IBA	cellular component
GO:0006508	proteolysis	IBA	biological process
GO:0004180	carboxypeptidase activity	IEA	molecular function
GO:0004181	metallocarboxypeptidase activity	IEA	molecular function
GO:0006508	proteolysis	IEA	biological process
GO:0008270	zinc ion binding	IEA	molecular function
GO:0004180	carboxypeptidase activity	IEA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0006508	proteolysis	IEA	biological process
GO:0008233	peptidase activity	IEA	molecular function
GO:0031410	cytoplasmic vesicle	IEA	cellular component
GO:0008237	metallopeptidase activity	IEA	molecular function
GO:0002003	angiotensin maturation	TAS	biological process
GO:0005576	extracellular region	TAS	cellular component
GO:0008233	peptidase activity	IEA	molecular function
GO:0002002	regulation of angiotensin levels in blood	IEA	biological process
GO:0062023	collagen-containing extracellular matrix	HDA	cellular component
GO:0005576	extracellular region	HDA	cellular component
GO:0030133	transport vesicle	IEA	cellular component
GO:0030141	secretory granule	NAS	cellular component
GO:0006508	proteolysis	TAS	biological process
GO:0004181	metallocarboxypeptidase activity	NAS	molecular function
GO:0004181	metallocarboxypeptidase activity	TAS	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04974	Protein digestion and absorption
hsa04972	Pancreatic secretion
hsa04614	Renin-angiotensin system

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Spermatogenic defects	MIK: 31037746
Spermatogenic failure	MIK: 17921478
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray
17921478	Spermatogenic failure			69 samples	Male infertility	Microarray