• Gene id: 1358

Gene Summary

• Gene Symbol: CPA2   Gene   UCSC   Ensembl
• Gene name: carboxypeptidase A2
• Alternate names: carboxypeptidase A2, carboxypeptidase A2 (pancreatic),
• Gene location: 7q32.2 (130266862: 130289797)     Exons: 11     NC_000007.14
• Gene summary(Entrez): Three different forms of human pancreatic procarboxypeptidase A have been isolated. The encoded protein represents the A2 form, which is a monomeric protein with different biochemical properties from the A1 and A3 forms. The A2 form of pancreatic procarbo
• OMIM: 102776

Protein Summary

• Protein general information: P48052  
  • Name: Carboxypeptidase A2 (EC 3.4.17.15)
  • Length: 419  
  • Mass: 47030
• Sequence:

  MAMRLILFFGALFGHIYCLETFVGDQVLEIVPSNEEQIKNLLQLEAQEHLQLDFWKSPTTPGETAHVRVPFVNVQ
  AVKVFLESQGIAYSIMIEDVQVLLDKENEEMLFNRRRERSGNFNFGAYHTLEEISQEMDNLVAEHPGLVSKVNIG
  SSFENRPMNVLKFSTGGDKPAIWLDAGIHAREWVTQATALWTANKIVSDYGKDPSITSILDALDIFLLPVTNPDG
  YVFSQTKNRMWRKTRSKVSGSLCVGVDPNRNWDAGFGGPGASSNPCSDSYHGPSANSEVEVKSIVDFIKSHGKVK
  AFITLHSYSQLLMFPYGYKCTKLDDFDELSEVAQKAAQSLRSLHGTKYKVGPICSVIYQASGGSIDWSYDYGIKY
  SFAFELRDTGRYGFLLPARQILPTAEETWLGLKAIMEHVRDHPY

• Structural information:
  • Interpro: IPR034248  IPR036990  IPR003146  IPR000834  
  • Prosite: PS00132 PS00133
  • CDD: cd03870
  • PDB: 1AYE 1DTD 1O6X
  • PDBsum: 1AYE 1DTD 1O6X
  • STRING: ENSP00000222481
• Other Databases: GeneCards:  CPA2  Malacards:  CPA2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004181	metallocarboxypeptidase activity	IBA	molecular function
GO:0005615	extracellular space	IBA	cellular component
GO:0006508	proteolysis	IBA	biological process
GO:0004180	carboxypeptidase activity	IEA	molecular function
GO:0004181	metallocarboxypeptidase activity	IEA	molecular function
GO:0006508	proteolysis	IEA	biological process
GO:0008270	zinc ion binding	IEA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0004180	carboxypeptidase activity	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0046872	metal ion binding	IEA	molecular function
GO:0008233	peptidase activity	IEA	molecular function
GO:0006508	proteolysis	IEA	biological process
GO:0008237	metallopeptidase activity	IEA	molecular function
GO:0004181	metallocarboxypeptidase activity	TAS	molecular function
GO:0007039	protein catabolic process in the vacuole	TAS	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0005773	vacuole	IEA	cellular component
GO:0008270	zinc ion binding	IDA	molecular function
GO:0004180	carboxypeptidase activity	IDA	molecular function
GO:0005576	extracellular region	IDA	cellular component
GO:0004181	metallocarboxypeptidase activity	IDA	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04974	Protein digestion and absorption
hsa04972	Pancreatic secretion

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq