• Gene id: 135644

Gene Summary

• Gene Symbol: TRIM40   Gene   UCSC   Ensembl
• Aliases: RNF35
• Gene name: tripartite motif containing 40
• Alternate names: tripartite motif-containing protein 40, RING finger protein 35, probable E3 NEDD8-protein ligase, ring finger RNF35,
• Gene location: 6p22.1 (30135997: 30148772)     Exons: 6     NC_000006.12
• Gene summary(Entrez): This gene encodes a member of the tripartite motif (TRIM) protein family. The encoded protein may play a role as a negative regulator against inflammation and carcinogenesis in the gastrointestinal tract. Alternatively spliced transcript variants that enc
• OMIM: 616976

Protein Summary

• Protein general information: Q6P9F5  
  • Name: Tripartite motif containing protein 40 (Probable E3 NEDD8 protein ligase) (RING finger protein 35)
  • Length: 258  
  • Mass: 29336
  • Tissue specificity: Highly expressed in normal gastrointestinal epithelia but that is down-regulated in gastrointestinal carcinomas and chronic inflammatory lesions of the gastrointestinal tract. {ECO
• Sequence:

  MIPLQKDNQEEGVCPICQESLKEAVSTNCGHLFCRVCLTQHVEKASASGVFCCPLCRKPCSEEVLGTGYICPNHQ
  KRVCRFCEESRLLLCVECLVSPEHMSHHELTIENALSHYKERLNRRSRKLRKDIAELQRLKAQQEKKLQALQFQV
  DHGNHRLEAGPESQHQTREQLGALPQQWLGQLEHMPAEAARILDISRAVTQLRSLVIDLERTAKELDTNTLKNAG
  DLLNRSAPQKLEVIYPQLEKGVSELLLQPPQKL

• Structural information:
  • Interpro: IPR000315  IPR018957  IPR001841  IPR013083  IPR017907  
  • Prosite: PS50119 PS00518 PS50089
  • STRING: ENSP00000379826
• Other Databases: GeneCards:  TRIM40  Malacards:  TRIM40

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0032088	negative regulation of NF-kappaB transcription factor activity	IBA	biological process
GO:0016567	protein ubiquitination	IBA	biological process
GO:0010468	regulation of gene expression	IBA	biological process
GO:0005737	cytoplasm	IBA	cellular component
GO:0061630	ubiquitin protein ligase activity	IBA	molecular function
GO:0045087	innate immune response	IBA	biological process
GO:0008270	zinc ion binding	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0030308	negative regulation of cell growth	IEA	biological process
GO:0032088	negative regulation of NF-kappaB transcription factor activity	IEA	biological process
GO:0045116	protein neddylation	IDA	biological process
GO:0032088	negative regulation of NF-kappaB transcription factor activity	IDA	biological process
GO:1900181	negative regulation of protein localization to nucleus	IDA	biological process
GO:0042177	negative regulation of protein catabolic process	IDA	biological process
GO:0008385	IkappaB kinase complex	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:1901223	negative regulation of NIK/NF-kappaB signaling	NAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881