• Gene id: 135458

Gene Summary

• Gene Symbol: HUS1B   Gene   UCSC   Ensembl
• Gene name: HUS1 checkpoint clamp component B
• Alternate names: checkpoint protein HUS1B, HUS1 checkpoint homolog b, hHUS1B,
• Gene location: 6p25.3 (656963: 655938)     Exons: 1     NC_000006.12
• Gene summary(Entrez): The protein encoded by this gene is most closely related to HUS1, a component of a cell cycle checkpoint protein complex involved in cell cycle arrest in response to DNA damage. This protein can interact with the check point protein RAD1 but not with RAD9
• OMIM: 615627

Protein Summary

• Protein general information: Q8NHY5  
  • Name: Checkpoint protein HUS1B (hHUS1B)
  • Length: 278  
  • Mass: 30982
  • Tissue specificity: Expressed strongly in testis, less in spleen, thymus, prostate, colon and leukocytes. {ECO
• Sequence:

  MKFRAKITGKGCLELFIHVSGTVARLAKVCVLRVRPDSLCFGPAGSGGLHEARLWCEVRQGAFQQFRMEGVSEDL
  DEIHLELTAEHLSRAARSAAGASSLKLQLTHKRRPSLTVAVELVSSLGRARSVVHDLPVRVLPRRVWRDCLPPSL
  RASDASIRLPRWRTLRSIVERMANVGSHVLVEANLSGRMTLSIETEVVSIQSYFKNLGNPPQSAVGVPENRDLES
  MVQVRVDNRKLLQFLEGQQIHPTTALCNIWDNTLLQLVLVQEDVSLQYFIPAL

• Structural information:
  • Interpro: IPR016580  IPR007150  
  • STRING: ENSP00000370293
• Other Databases: GeneCards:  HUS1B  Malacards:  HUS1B

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000724	double-strand break repair via homologous recombination	IBA	biological process
GO:0030896	checkpoint clamp complex	IBA	cellular component
GO:0031573	intra-S DNA damage checkpoint	IBA	biological process
GO:0033314	mitotic DNA replication checkpoint	IBA	biological process
GO:0035861	site of double-strand break	IBA	cellular component
GO:0044778	meiotic DNA integrity checkpoint	IBA	biological process
GO:0000723	telomere maintenance	IBA	biological process
GO:0006289	nucleotide-excision repair	IBA	biological process
GO:0000077	DNA damage checkpoint	IEA	biological process
GO:0005730	nucleolus	IEA	cellular component
GO:0030896	checkpoint clamp complex	IEA	cellular component
GO:0000724	double-strand break repair via homologous recombination	IBA	biological process
GO:0030896	checkpoint clamp complex	IBA	cellular component
GO:0031573	intra-S DNA damage checkpoint	IBA	biological process
GO:0033314	mitotic DNA replication checkpoint	IBA	biological process
GO:0035861	site of double-strand break	IBA	cellular component
GO:0044778	meiotic DNA integrity checkpoint	IBA	biological process
GO:0000723	telomere maintenance	IBA	biological process
GO:0006289	nucleotide-excision repair	IBA	biological process
GO:0000077	DNA damage checkpoint	IEA	biological process
GO:0005730	nucleolus	IEA	cellular component
GO:0030896	checkpoint clamp complex	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881