• Gene id: 1353

Gene Summary

• Gene Symbol: COX11   Gene   UCSC   Ensembl
• Aliases: COX11P
• Gene name: cytochrome c oxidase copper chaperone COX11
• Alternate names: cytochrome c oxidase assembly protein COX11, mitochondrial, COX11 homolog, cytochrome c oxidase assembly protein, COX11, cytochrome c oxidase copper chaperone, cytochrome c oxidase subunit 11,
• Gene location: 17q22 (112297342: 112442620)     Exons: 16     NC_000004.12
• Gene summary(Entrez): Cytochrome c oxidase (COX), the terminal component of the mitochondrial respiratory chain, catalyzes the electron transfer from reduced cytochrome c to oxygen. This component is a heteromeric complex consisting of 3 catalytic subunits encoded by mitochond
• OMIM: 603648

Protein Summary

• Protein general information: Q9Y6N1  
  • Name: Cytochrome c oxidase assembly protein COX11, mitochondrial
  • Length: 276  
  • Mass: 31430
  • Tissue specificity: Ubiquitous. {ECO
• Sequence:

  MGGLWRPGWRCVPFCGWRWIHPGSPTRAAERVEPFLRPEWSGTGGAERGLRWLGTWKRCSLRARHPALQPPRRPK
  SSNPFTRAQEEERRRQNKTTLTYVAAVAVGMLGASYAAVPLYRLYCQTTGLGGSAVAGHASDKIENMVPVKDRII
  KISFNADVHASLQWNFRPQQTEIYVVPGETALAFYRAKNPTDKPVIGISTYNIVPFEAGQYFNKIQCFCFEEQRL
  NPQEEVDMPVFFYIDPEFAEDPRMIKVDLITLSYTFFEAKEGHKLPVPGYN

• Structural information:
  • Interpro: IPR023471  IPR007533  
  • STRING: ENSP00000299335
• Other Databases: GeneCards:  COX11  Malacards:  COX11

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0031305	integral component of mitochondrial inner membrane	IDA	cellular component
GO:0005507	copper ion binding	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005743	mitochondrial inner membrane	IEA	cellular component
GO:0005739	mitochondrion	TAS	cellular component
GO:0033132	negative regulation of glucokinase activity	IEA	biological process
GO:0005739	mitochondrion	IEA	cellular component
GO:0005743	mitochondrial inner membrane	IEA	cellular component
GO:0022900	electron transport chain	IEA	biological process
GO:0055065	metal ion homeostasis	IDA	biological process
GO:0032991	protein-containing complex	IDA	cellular component
GO:0009055	electron transfer activity	TAS	molecular function
GO:0005515	protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa04714	Thermogenesis
hsa00190	Oxidative phosphorylation

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881