About Us

Search Result


Gene id 135295
Gene Summary    Protein Summary    Gene ontology    Diseases    PubMed    

Gene Summary

Gene Symbol SRSF12   Gene   UCSC   Ensembl
Aliases SFRS13B, SFRS19, SRrp35
Gene name serine and arginine rich splicing factor 12
Alternate names serine/arginine-rich splicing factor 12, 35 kDa SR repressor protein, SR splicing factor 12, serine-arginine repressor protein (35 kDa), splicing factor, arginine/serine-rich 13B, splicing factor, arginine/serine-rich 19,
Gene location 6q15 (89118070: 89095956)     Exons: 7     NC_000006.12

Protein Summary

Protein general information Q8WXF0  

Name: Serine/arginine rich splicing factor 12 (35 kDa SR repressor protein) (SRrp35) (Splicing factor, arginine/serine rich 13B) (Splicing factor, arginine/serine rich 19)

Length: 261  Mass: 30512

Tissue specificity: Expressed in testis. {ECO

Sequence MSRYTRPPNTSLFIRNVADATRPEDLRREFGRYGPIVDVYIPLDFYTRRPRGFAYVQFEDVRDAEDALYNLNRKW
VCGRQIEIQFAQGDRKTPGQMKSKERHPCSPSDHRRSRSPSQRRTRSRSSSWGRNRRRSDSLKESRHRRFSYSQS
KSRSKSLPRRSTSARQSRTPRRNFGSRGRSRSKSLQKRSKSIGKSQSSSPQKQTSSGTKSRSHGRHSDSIARSPC
KSPKGYTNSETKVQTAKHSHFRSHSRSRSYRHKNSW
Structural information
Protein Domains
(10..8-)
(/note="RRM-)
(/evidence="ECO:0000255|PROSITE-ProRule:PRU00176"-)
Interpro:  IPR012677  IPR035979  IPR000504  IPR034477  
Prosite:   PS50102
STRING:   ENSP00000414302
Other Databases GeneCards:  SRSF12  Malacards:  SRSF12

Gene ontology

Expand All | Collapse All

GO accessionTerm nameEvidence codeGo category
GO:0003723 RNA binding
IBA molecular function
GO:0005634 nucleus
IBA cellular component
GO:0005737 cytoplasm
IBA cellular component
GO:0016607 nuclear speck
IBA cellular component
GO:0045292 mRNA cis splicing, via sp
liceosome
IBA biological process
GO:0000381 regulation of alternative
mRNA splicing, via splic
eosome
IBA biological process
GO:0000381 regulation of alternative
mRNA splicing, via splic
eosome
IEA biological process
GO:0003676 nucleic acid binding
IEA molecular function
GO:0006397 mRNA processing
IEA biological process
GO:0003723 RNA binding
IEA molecular function
GO:0008380 RNA splicing
IEA biological process
GO:0005634 nucleus
IEA cellular component
GO:0005634 nucleus
IEA cellular component
GO:0000395 mRNA 5'-splice site recog
nition
IDA biological process
GO:0000381 regulation of alternative
mRNA splicing, via splic
eosome
IDA biological process
GO:0050733 RS domain binding
NAS molecular function
GO:0003723 RNA binding
NAS molecular function
GO:0000244 spliceosomal tri-snRNP co
mplex assembly
NAS biological process
GO:0051082 unfolded protein binding
NAS molecular function
GO:0005654 nucleoplasm
ISS cellular component
GO:0048025 negative regulation of mR
NA splicing, via spliceos
ome
ISS biological process
GO:0003723 RNA binding
HDA molecular function
Associated diseases References
Teratozoospermia MIK: 17327269

PubMed references

Expand All | Collapse All

PMID Condition Mutation Ethnicity Population details Infertility_type Associated_genes Abstract
17327269 Teratozoos
permia

13 (5 controls,
8 cases)
Male infertility GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
Show abstract
17327269 Teratozoos
permia

19 (6 controls
, 13 cases)
Male infertility GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
Show abstract