• Gene id: 135293

Gene Summary

• Gene Symbol: PM20D2   Gene   UCSC   Ensembl
• Aliases: ACY1L2
• Gene name: peptidase M20 domain containing 2
• Alternate names: peptidase M20 domain-containing protein 2, I(2)-alanyl-lysine dipeptidase, aminoacylase-1-like protein 2, beta-alanyl-lysine dipeptidase,
• Gene location: 6q15 (89094817: 89165564)     Exons: 13     NC_000006.12
• OMIM: 615913

Protein Summary

• Protein general information: Q8IYS1  
  • Name: Peptidase M20 domain containing protein 2 (Aminoacylase 1 like protein 2)
  • Length: 436  
  • Mass: 47776
• Sequence:

  MRPGGERPVEGGACNGRSELELLKLRSAECIDEAAERLGALSRAIWSQPELAYEEHHAHRVLTHFFEREPPAASW
  AVQPHYQLPTAFRAEWEPPEARAPSATPRPLHLGFLCEYDALPGIGHACGHNLIAEVGAAAALGVRGALEGLPRP
  PPPVKVVVLGTPAEEDGGGKIDLIEAGAFTNLDVVFMAHPSQENAAYLPDMAEHDVTVKYYGKASHSASYPWEGL
  NALDAAVLAYNNLSVFRQQMKPTWRVHGIIKNGGVKPNIIPSYSELIYYFRAPSMKELQVLTKKAEDCFRAAALA
  SGCTVEIKGGAHDYYNVLPNKSLWKAYMENGRKLGIEFISEDTMLNGPSGSTDFGNVSFVVPGIHPYFHIGSNAL
  NHTEQYTEAAGSQEAQFYTLRTAKALAMTALDVIFKPELLEGIREDFKLKLQEEQFVNAVE

• Structural information:
  • Interpro: IPR036264  IPR017144  IPR002933  IPR011650  
  • STRING: ENSP00000275072
• Other Databases: GeneCards:  PM20D2  Malacards:  PM20D2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0046657	folic acid catabolic process	IBA	NOT|biological process
GO:0071713	para-aminobenzoyl-glutamate hydrolase activity	IBA	NOT|molecular function
GO:0016805	dipeptidase activity	IBA	molecular function
GO:0005737	cytoplasm	IBA	NOT|cellular component
GO:0016787	hydrolase activity	IEA	molecular function
GO:0006508	proteolysis	IDA	biological process
GO:0032268	regulation of cellular protein metabolic process	IDA	biological process
GO:0016805	dipeptidase activity	IDA	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0006508	proteolysis	IEA	biological process
GO:0006508	proteolysis	IEA	biological process
GO:0016805	dipeptidase activity	IEA	molecular function
GO:0016805	dipeptidase activity	IEA	molecular function
GO:0032268	regulation of cellular protein metabolic process	IEA	biological process
GO:0005654	nucleoplasm	IDA	cellular component

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)