• Gene id: 135250

Gene Summary

• Gene Symbol: RAET1E   Gene   UCSC   Ensembl
• Aliases: LETAL, N2DL-4, NKG2DL4, RAET1E2, RL-4, ULBP4, bA350J20.7
• Gene name: retinoic acid early transcript 1E
• Alternate names: retinoic acid early transcript 1E, NKG2D ligand 4, RAE-1-like transcript 4, UL16-binding protein 4, lymphocyte effector toxicity activation ligand,
• Gene location: 6q25.1 (149898352: 149864398)     Exons: 10     NC_000006.12
• Gene summary(Entrez): This gene belong to the RAET1 family, which consists of major histocompatibility complex (MHC) class I-related genes located in a cluster on chromosome 6q24.2-q25.3. This and RAET1G protein differ from other RAET1 proteins in that they have type I membran
• OMIM: 609243

Protein Summary

• Protein general information: Q8TD07  
  • Name: Retinoic acid early transcript 1E (Lymphocyte effector toxicity activation ligand) (NKG2D ligand 4) (N2DL 4) (NKG2DL4) (RAE 1 like transcript 4) (UL16 binding protein 4)
  • Length: 263  
  • Mass: 30122
  • Tissue specificity: Predominantly expressed in the skin, but also expressed in testis and trachea. Up-regulated in tumor cells of different origins. Expression progressively decreased after treatment of tumor cells with retinoic acid. {ECO
• Sequence:

  MRRISLTSSPVRLLLFLLLLLIALEIMVGGHSLCFNFTIKSLSRPGQPWCEAQVFLNKNLFLQYNSDNNMVKPLG
  LLGKKVYATSTWGELTQTLGEVGRDLRMLLCDIKPQIKTSDPSTLQVEMFCQREAERCTGASWQFATNGEKSLLF
  DAMNMTWTVINHEASKIKETWKKDRGLEKYFRKLSKGDCDHWLREFLGHWEAMPEPTVSPVNASDIHWSSSSLPD
  RWIILGAFILLVLMGIVLICVWWQNGEWQAGLWPLRTS

• Structural information:
  • Interpro: IPR011161  IPR037055  IPR011162  
  • STRING: ENSP00000349709
• Other Databases: GeneCards:  RAET1E  Malacards:  RAET1E

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005886	plasma membrane	NAS	cellular component
GO:0005615	extracellular space	IBA	cellular component
GO:0009897	external side of plasma membrane	IBA	cellular component
GO:0045954	positive regulation of natural killer cell mediated cytotoxicity	IDA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0002376	immune system process	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0050776	regulation of immune response	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0042267	natural killer cell mediated cytotoxicity	IDA	biological process
GO:0046703	natural killer cell lectin-like receptor binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04650	Natural killer cell mediated cytotoxicity

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)