• Gene id: 135138

Gene Summary

• Gene Symbol: PACRG   Gene   UCSC   Ensembl
• Aliases: GLUP, HAK005771, PARK2CRG
• Gene name: parkin coregulated
• Alternate names: parkin coregulated gene protein, PARK2 co-regulated, PARK2 coregulated, molecular chaperone/chaperonin-binding protein, parkin co-regulated gene protein,
• Gene location: 6q26 (162726869: 163315491)     Exons: 23     NC_000006.12
• Gene summary(Entrez): This gene encodes a protein that is conserved across metazoans. In vertebrates, this gene is linked in a head-to-head arrangement with the adjacent parkin gene, which is associated with autosomal recessive juvenile Parkinson's disease. These genes are co-
• OMIM: 608427

Protein Summary

• Protein general information: Q96M98  
  • Name: Parkin coregulated gene protein (Molecular chaperone/chaperonin binding protein) (PARK2 coregulated gene protein)
  • Length: 296  
  • Mass: 33,342
• Sequence:

  MVAEKETLSLNKCPDKMPKRTKLLAQQPLPVHQPHSLVSEGFTVKAMMKNSVVRGPPAAGAFKERPTKPTAFRKF
  YERGDFPIALEHDSKGNKIAWKVEIEKLDYHHYLPLFFDGLCEMTFPYEFFARQGIHDMLEHGGNKILPVLPQLI
  IPIKNALNLRNRQVICVTLKVLQHLVVSAEMVGKALVPYYRQILPVLNIFKNMNGSYSLPRLECSGAIMARCNLD
  HLGSSDPPTSASQVAEIIVNSGDGIDYSQQKRENIGDLIQETLEAFERYGGENAFINIKYVVPTYESCLLN

• Structural information:
  • Interpro: IPR019399  
  • STRING: ENSP00000337946
• Other Databases: GeneCards:  PACRG  Malacards:  PACRG

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001664	G-protein coupled receptor binding	IPI	molecular function
GO:0003779	actin binding	IDA	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0007286	spermatid development	IEA	biological process
GO:0030544	Hsp70 protein binding	IDA	molecular function
GO:0031072	heat shock protein binding	IPI	molecular function
GO:0031625	ubiquitin protein ligase binding	IPI	molecular function
GO:0031982	vesicle	IDA	cellular component
GO:0034620	cellular response to unfolded protein	TAS	biological process
GO:0043005	neuron projection	IDA	cellular component
GO:0043014	alpha-tubulin binding	IDA	molecular function
GO:0044297	cell body	IEA	cellular component
GO:0048487	beta-tubulin binding	IDA	molecular function
GO:0051087	chaperone binding	IPI	molecular function
GO:0051879	Hsp90 protein binding	IDA	molecular function
GO:0060548	negative regulation of cell death	IMP	biological process
GO:0097225	sperm midpiece	IEA	cellular component
GO:0001664	G-protein coupled receptor binding	IPI	molecular function
GO:0003779	actin binding	IDA	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0005829	cytosol	IEA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0005929	cilium	IEA	cellular component
GO:0007286	spermatid development	IEA	biological process
GO:0030544	Hsp70 protein binding	IDA	molecular function
GO:0031072	heat shock protein binding	IPI	molecular function
GO:0031625	ubiquitin protein ligase binding	IEA	molecular function
GO:0031625	ubiquitin protein ligase binding	IPI	molecular function
GO:0031982	vesicle	IEA	cellular component
GO:0031982	vesicle	IDA	cellular component
GO:0034620	cellular response to unfolded protein	TAS	biological process
GO:0043005	neuron projection	IEA	cellular component
GO:0043005	neuron projection	IDA	cellular component
GO:0043014	alpha-tubulin binding	IDA	molecular function
GO:0044297	cell body	IEA	cellular component
GO:0048487	beta-tubulin binding	IDA	molecular function
GO:0051087	chaperone binding	IPI	molecular function
GO:0051879	Hsp90 protein binding	IDA	molecular function
GO:0060548	negative regulation of cell death	IEA	biological process
GO:0060548	negative regulation of cell death	IMP	biological process
GO:0097225	sperm midpiece	IEA	cellular component
GO:0001664	G-protein coupled receptor binding	IPI	molecular function
GO:0003779	actin binding	IDA	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0030544	Hsp70 protein binding	IDA	molecular function
GO:0031072	heat shock protein binding	IPI	molecular function
GO:0031625	ubiquitin protein ligase binding	IPI	molecular function
GO:0031982	vesicle	IDA	cellular component
GO:0034620	cellular response to unfolded protein	TAS	biological process
GO:0043005	neuron projection	IDA	cellular component
GO:0043014	alpha-tubulin binding	IDA	molecular function
GO:0048487	beta-tubulin binding	IDA	molecular function
GO:0051087	chaperone binding	IPI	molecular function
GO:0051879	Hsp90 protein binding	IDA	molecular function
GO:0060548	negative regulation of cell death	IMP	biological process

Diseases

Associated diseases	References
Parkinson disease	GAD: 15925106
Male factor infertility	MIK: 19268936
Oligozoospermia	MIK: 19268936
Azoospermia	MIK: 19268936
Cryptorchidism	MIK: 28606200
Male infertility	MIK: 19268936
Azoospermia	MIK: 19268936
Oligozoospermia	MIK: 19268936
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
19268936	Male infertility, Azoospermia, Oligozoospermia			766 (610 patients, 156 normal control subjects)	Male infertility
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray