• Gene id: 135114

Gene Summary

• Gene Symbol: HINT3   Gene   UCSC   Ensembl
• Aliases: HINT4
• Gene name: histidine triad nucleotide binding protein 3
• Alternate names: histidine triad nucleotide-binding protein 3, HINT-3, HIT-like protein,
• Gene location: 6q22.32 (125956769: 125980243)     Exons: 5     NC_000006.12
• Gene summary(Entrez): Histidine triad proteins, such as HINT3, are nucleotide hydrolases and transferases that act on the alpha-phosphate of ribonucleotides (Brenner, 2002 [PubMed 12119013]).[supplied by OMIM, Mar 2008]
• OMIM: 609998

Protein Summary

• Protein general information: Q9NQE9  
  • Name: Histidine triad nucleotide binding protein 3 (HINT 3) (EC 3. . . )
  • Length: 182  
  • Mass: 20361
• Sequence:

  MAEEQVNRSAGLAPDCEASATAETTVSSVGTCEAAGKSPEPKDYDSTCVFCRIAGRQDPGTELLHCENEDLICFK
  DIKPAATHHYLVVPKKHIGNCRTLRKDQVELVENMVTVGKTILERNNFTDFTNVRMGFHMPPFCSISHLHLHVLA
  PVDQLGFLSKLVYRVNSYWFITADHLIEKLRT

• Structural information:
  • Protein Domains: (49..16-)
    (/note="HIT-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00464"-)
  • Interpro: IPR011146  IPR036265  
  • Prosite: PS51084
  • STRING: ENSP00000229633
• Other Databases: GeneCards:  HINT3  Malacards:  HINT3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0003824	catalytic activity	IEA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0000166	nucleotide binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0042802	identical protein binding	IDA	molecular function
GO:0016787	hydrolase activity	IDA	molecular function
GO:0005634	nucleus	IMP	cellular component
GO:0005737	cytoplasm	IMP	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 21412036
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21412036	Cryptorchidism			23 (4 controls, 19 cases)	Male infertility	GSE25518 analyzed by GEO2R (cutoff 1.5 fold)
21412036	Cryptorchidism			23 (4 controls, 19 cases)	Male infertility	GSE25518 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R