• Gene id: 135112

Gene Summary

• Gene Symbol: NCOA7   Gene   UCSC   Ensembl
• Aliases: ERAP140, ESNA1, NCOA7-AS, Nbla00052, Nbla10993, TLDC4, dJ187J11.3
• Gene name: nuclear receptor coactivator 7
• Alternate names: nuclear receptor coactivator 7, 140 kDa estrogen receptor-associated protein, TBC/LysM-associated domain containing 4, estrogen nuclear receptor coactivator 1, estrogen receptor associated protein 140 kDa, putative protein product of Nbla00052, putative protein,
• Gene location: 6q22.31-q22.32 (125780942: 125932033)     Exons: 23     NC_000006.12
• OMIM: 612392

Protein Summary

• Protein general information: Q8NI08  
  • Name: Nuclear receptor coactivator 7 (140 kDa estrogen receptor associated protein) (Estrogen nuclear receptor coactivator 1)
  • Length: 942  
  • Mass: 106162
  • Tissue specificity: Highly expressed in brain. Weakly expressed in mammary gland, ovary, uterus, prostate, stomach, bladder, spinal cord and pancreas. Expressed in cancer cell line. {ECO
• Sequence:

  MDTKEEKKERKQSYFARLKKKKQAKQNAETASAVATRTHTGKEDNNTVVLEPDKCNIAVEEEYMTDEKKKRKSNQ
  LKEIRRTELKRYYSIDDNQNKTHDKKEKKMVVQKPHGTMEYTAGNQDTLNSIALKFNITPNKLVELNKLFTHTIV
  PGQVLFVPDANSPSSTLRLSSSSPGATVSPSSSDAEYDKLPDADLARKALKPIERVLSSTSEEDEPGVVKFLKMN
  CRYFTDGKGVVGGVMIVTPNNIMFDPHKSDPLVIENGCEEYGLICPMEEVVSIALYNDISHMKIKDALPSDLPQD
  LCPLYRPGEWEDLASEKDINPFSKFKSINKEKRQQNGEKIMTSDSRPIVPLEKSTGHTPTKPSGSSVSEKLKKLD
  SSRETSHGSPTVTKLSKEPSDTSSAFESTAKENFLGEDDDFVDLEELSSQTGGGMHKKDTLKECLSLDPEERKKA
  ESQINNSAVEMQVQSALAFLGTENDVELKGALDLETCEKQDIMPEVDKQSGSPESRVENTLNIHEDLDKVKLIEY
  YLTKNKEGPQVSENLQKTELSDGKSIEPGGIDITLSSSLSQAGDPITEGNKEPDKTWVKKGEPLPVKLNSSTEAN
  VIKEALDSSLESTLDNSCQGAQMDNKSEVQLWLLKRIQVPIEDILPSKEEKSKTPPMFLCIKVGKPMRKSFATHT
  AAMVQQYGKRRKQPEYWFAVPRERVDHLYTFFVQWSPDVYGKDAKEQGFVVVEKEELNMIDNFFSEPTTKSWEII
  TVEEAKRRKSTCSYYEDEDEEVLPVLRPHSALLENMHIEQLARRLPARVQGYPWRLAYSTLEHGTSLKTLYRKSA
  SLDSPVLLVIKDMDNQIFGAYATHPFKFSDHYYGTGETFLYTFSPHFKVFKWSGENSYFINGDISSLELGGGGGR
  FGLWLDADLYHGRSNSCSTFNNDILSKKEDFIVQDLEVWAFD

• Structural information:
  • Protein Domains: (114..15-)
    (/note="LysM-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU01118-)
    (781..94-)
    (/note="TLDc-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU01234"-)
  • Interpro: IPR018392  IPR036779  IPR006571  
  • Prosite: PS51782 PS51886
  • CDD: cd00118
  • STRING: ENSP00000376269
• Other Databases: GeneCards:  NCOA7  Malacards:  NCOA7

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0030374	nuclear receptor transcription coactivator activity	IBA	molecular function
GO:0006979	response to oxidative stress	IBA	biological process
GO:0005634	nucleus	IBA	cellular component
GO:1903204	negative regulation of oxidative stress-induced neuron death	IBA	biological process
GO:0035257	nuclear hormone receptor binding	IDA	molecular function
GO:0045944	positive regulation of transcription by RNA polymerase II	IDA	biological process
GO:0030374	nuclear receptor transcription coactivator activity	IDA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005622	intracellular	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:1900408	negative regulation of cellular response to oxidative stress	IEA	biological process
GO:1902083	negative regulation of peptidyl-cysteine S-nitrosylation	IEA	biological process
GO:1903204	negative regulation of oxidative stress-induced neuron death	IEA	biological process
GO:0005634	nucleus	IEA	cellular component

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Hypospermatogenesis	MIK: 28361989

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray