• Gene id: 1350

Gene Summary

• Gene Symbol: COX7C   Gene   UCSC   Ensembl
• Gene name: cytochrome c oxidase subunit 7C
• Alternate names: cytochrome c oxidase subunit 7C, mitochondrial, cytochrome c oxidase polypeptide VIIc, cytochrome c oxidase subunit VIIc, cytochrome-c oxidase chain VIIc,
• Gene location: 5q14.3 (39934954: 40016390)     Exons: 11     NC_000008.11
• Gene summary(Entrez): Cytochrome c oxidase (COX), the terminal component of the mitochondrial respiratory chain, catalyzes the electron transfer from reduced cytochrome c to oxygen. This component is a heteromeric complex consisting of 3 catalytic subunits encoded by mitochond
• OMIM: 603774

Protein Summary

• Protein general information: P15954  
  • Name: Cytochrome c oxidase subunit 7C, mitochondrial (Cytochrome c oxidase polypeptide VIIc)
  • Length: 63  
  • Mass: 7246
• Sequence:

  MLGQSIRRFTTSVVRRSHYEEGPGKNLPFSVENKWSLLAKMCLYFGSAFATPFLVVRHQLLKT

• Structural information:
  • Interpro: IPR004202  IPR036636  
  • CDD: cd00929
  • PDB: 5Z62
  • PDBsum: 5Z62
  • STRING: ENSP00000425759
• Other Databases: GeneCards:  COX7C  Malacards:  COX7C

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006123	mitochondrial electron transport, cytochrome c to oxygen	IBA	biological process
GO:0004129	cytochrome-c oxidase activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0005743	mitochondrial inner membrane	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0006091	generation of precursor metabolites and energy	TAS	biological process
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0006123	mitochondrial electron transport, cytochrome c to oxygen	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005751	mitochondrial respiratory chain complex IV	IEA	cellular component
GO:0005743	mitochondrial inner membrane	IEA	cellular component
GO:1902600	proton transmembrane transport	IEA	biological process
GO:0006119	oxidative phosphorylation	IEA	biological process
GO:0005751	mitochondrial respiratory chain complex IV	IDA	cellular component
GO:0005739	mitochondrion	HDA	cellular component
GO:0005515	protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa05010	Alzheimer disease
hsa05016	Huntington disease
hsa05012	Parkinson disease
hsa04714	Thermogenesis
hsa00190	Oxidative phosphorylation
hsa04932	Non-alcoholic fatty liver disease
hsa04260	Cardiac muscle contraction

Diseases

Associated diseases	References
Alzheimer's disease	PMID:28474567
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)