• Gene id: 134510

Gene Summary

• Gene Symbol: UBLCP1   Gene   UCSC   Ensembl
• Aliases: CPUB1
• Gene name: ubiquitin like domain containing CTD phosphatase 1
• Alternate names: ubiquitin-like domain-containing CTD phosphatase 1, CTD phosphatase-like with ubiquitin domain 1, CTD-like phosphatase domain-containing protein, nuclear proteasome inhibitor UBLCP1,
• Gene location: 5q33.3 (159263289: 159286035)     Exons: 11     NC_000005.10
• OMIM: 609867

Protein Summary

• Protein general information: Q8WVY7  
  • Name: Ubiquitin like domain containing CTD phosphatase 1 (EC 3.1.3.16) (Nuclear proteasome inhibitor UBLCP1)
  • Length: 318  
  • Mass: 36805
  • Tissue specificity: Broadly expressed, with highest levels in placenta, lung, testis and ovary. Up-regulated in tumor tissues. {ECO
• Sequence:

  MALPIIVKWGGQEYSVTTLSEDDTVLDLKQFLKTLTGVLPERQKLLGLKVKGKPAENDVKLGALKLKPNTKIMMM
  GTREESLEDVLGPPPDNDDVVNDFDIEDEVVEVENREENLLKISRRVKEYKVEILNPPREGKKLLVLDVDYTLFD
  HRSCAETGVELMRPYLHEFLTSAYEDYDIVIWSATNMKWIEAKMKELGVSTNANYKITFMLDSAAMITVHTPRRG
  LIDVKPLGVIWGKFSEFYSKKNTIMFDDIGRNFLMNPQNGLKIRPFMKAHLNRDKDKELLKLTQYLKEIAKLDDF
  LDLNHKYWERYLSKKQGQ

• Structural information:
  • Protein Domains: (3..8-)
    (/note="Ubiquitin-like-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00214-)
    (133..29-)
    (/note="FCP1-homology)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00336"-)
  • Interpro: IPR004274  IPR036412  IPR011943  IPR023214  IPR000626   IPR029071  
  • Prosite: PS50969 PS50053
  • PDB: 2KX3 2LGD 2M17
  • PDBsum: 2KX3 2LGD 2M17
  • STRING: ENSP00000296786
• Other Databases: GeneCards:  UBLCP1  Malacards:  UBLCP1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004722	protein serine/threonine phosphatase activity	IBA	molecular function
GO:0005634	nucleus	IBA	cellular component
GO:0006470	protein dephosphorylation	IBA	biological process
GO:0004721	phosphoprotein phosphatase activity	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0004721	phosphoprotein phosphatase activity	IEA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0004721	phosphoprotein phosphatase activity	IEA	molecular function
GO:0004722	protein serine/threonine phosphatase activity	IDA	molecular function
GO:0006470	protein dephosphorylation	IDA	biological process
GO:0005634	nucleus	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005730	nucleolus	IDA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881