• Gene id: 134429

Gene Summary

• Gene Symbol: STARD4   Gene   UCSC   Ensembl
• Gene name: StAR related lipid transfer domain containing 4
• Alternate names: stAR-related lipid transfer protein 4, START domain containing 4, sterol regulated, START domain-containing protein 4, StAR-related lipid transfer (START) domain containing 4,
• Gene location: 5q22.1 (111512596: 111491421)     Exons: 8     NC_000005.10
• Gene summary(Entrez): Cholesterol homeostasis is regulated, at least in part, by sterol regulatory element (SRE)-binding proteins (e.g., SREBP1; MIM 184756) and by liver X receptors (e.g., LXRA; MIM 602423). Upon sterol depletion, LXRs are inactive and SREBPs are cleaved, afte
• OMIM: 176262

Protein Summary

• Protein general information: Q96DR4  
  • Name: StAR related lipid transfer protein 4 (START domain containing protein 4) (StARD4)
  • Length: 205  
  • Mass: 23517
• Sequence:

  MEGLSDVASFATKLKNTLIQYHSIEEDKWRVAKKTKDVTVWRKPSEEFNGYLYKAQGVIDDLVYSIIDHIRPGPC
  RLDWDSLMTSLDILENFEENCCVMRYTTAGQLWNIISPREFVDFSYTVGYKEGLLSCGISLDWDEKRPEFVRGYN
  HPCGWFCVPLKDNPNQSLLTGYIQTDLRGMIPQSAVDTAMASTLTNFYGDLRKAL

• Structural information:
  • Protein Domains: (1..20-)
    (/note="START-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00197"-)
  • Interpro: IPR042555  IPR023393  IPR002913  
  • Prosite: PS50848
  • PDB: 6L1D 6L1M
  • PDBsum: 6L1D 6L1M
  • STRING: ENSP00000296632
• Other Databases: GeneCards:  STARD4  Malacards:  STARD4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0031410	cytoplasmic vesicle	IDA	cellular component
GO:0070508	cholesterol import	IBA	biological process
GO:0005829	cytosol	IBA	cellular component
GO:0005783	endoplasmic reticulum	IBA	cellular component
GO:0120020	cholesterol transfer activity	IBA	molecular function
GO:0032367	intracellular cholesterol transport	IBA	biological process
GO:0015485	cholesterol binding	IBA	molecular function
GO:0010879	cholesterol transport involved in cholesterol storage	IBA	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:0008289	lipid binding	IEA	molecular function
GO:0015485	cholesterol binding	IEA	molecular function
GO:0032367	intracellular cholesterol transport	IEA	biological process
GO:0008289	lipid binding	IEA	molecular function
GO:0006869	lipid transport	IEA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0120020	cholesterol transfer activity	IDA	molecular function
GO:0015485	cholesterol binding	IDA	molecular function
GO:0070508	cholesterol import	IDA	biological process
GO:0070859	positive regulation of bile acid biosynthetic process	IDA	biological process
GO:0010879	cholesterol transport involved in cholesterol storage	IDA	biological process
GO:0032367	intracellular cholesterol transport	IDA	biological process
GO:0010873	positive regulation of cholesterol esterification	IDA	biological process
GO:0120009	intermembrane lipid transfer	IEA	biological process
GO:0120009	intermembrane lipid transfer	IEA	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881