• Gene id: 134353

Gene Summary

• Gene Symbol: LSM11   Gene   UCSC   Ensembl
• Gene name: LSM11, U7 small nuclear RNA associated
• Alternate names: U7 snRNA-associated Sm-like protein LSm11,
• Gene location: 5q33.3 (52450633: 52412601)     Exons: 15     NC_000013.11
• OMIM: 617910

Protein Summary

• Protein general information: P83369  
  • Name: U7 snRNA associated Sm like protein LSm11
  • Length: 360  
  • Mass: 39500
• Sequence:

  MEERERGARSAGAGSPARPPSPRLDVSSDSFDPLLALYAPRLPPIPYPNAPCFNNVAEYESFLRTGVRGGGRGRG
  RARGAAAGSGVPAAPGPSGRTRRRPDAPAPDPERIQRLRRLMVAKEEGDGAAGAGRRGPGRSRKAPRNVLTRMPL
  HEGSPLGELHRCIREGVKVNVHIRTFKGLRGVCTGFLVAFDKFWNMALTDVDETYRKPVLGKAYERDSSLTLTRL
  FDRLKLQDSSKKEADSKSAVEDSTLSRYSQTSTWKLASVWGRADTGRGSHKRSRSVPSSLQASAREESRSELSGR
  TTRTDGSSVGGTFSRATTLSRGQSRKKKRKPKVDYQQVFTRHINQIFIRGENVLLVHLAQ

• Structural information:
  • Interpro: IPR039267  IPR034109  IPR001163  IPR010920  
  • CDD: cd01739
  • STRING: ENSP00000286307
• Other Databases: GeneCards:  LSM11  Malacards:  LSM11

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005683	U7 snRNP	IBA	cellular component
GO:0006398	mRNA 3'-end processing by stem-loop binding and cleavage	IBA	biological process
GO:0071209	U7 snRNA binding	IBA	molecular function
GO:0006398	mRNA 3'-end processing by stem-loop binding and cleavage	ISS	biological process
GO:0005683	U7 snRNP	ISS	cellular component
GO:0071204	histone pre-mRNA 3'end processing complex	ISS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0071209	U7 snRNA binding	IEA	molecular function
GO:0003723	RNA binding	IEA	molecular function
GO:0006397	mRNA processing	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0006369	termination of RNA polymerase II transcription	TAS	biological process
GO:0008334	histone mRNA metabolic process	TAS	biological process
GO:0008334	histone mRNA metabolic process	TAS	biological process
GO:0008334	histone mRNA metabolic process	TAS	biological process
GO:0008334	histone mRNA metabolic process	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0006398	mRNA 3'-end processing by stem-loop binding and cleavage	IEA	biological process
GO:0005683	U7 snRNP	IEA	cellular component
GO:0071204	histone pre-mRNA 3'end processing complex	IEA	cellular component
GO:0071209	U7 snRNA binding	IPI	molecular function
GO:0005697	telomerase holoenzyme complex	IDA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0016604	nuclear body	IDA	cellular component
GO:0005683	U7 snRNP	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0071209	U7 snRNA binding	IDA	molecular function
GO:1900087	positive regulation of G1/S transition of mitotic cell cycle	IMP	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881