• Gene id: 134266

Gene Summary

• Gene Symbol: GRPEL2   Gene   UCSC   Ensembl
• Aliases: Mt-GrpE#2
• Gene name: GrpE like 2, mitochondrial
• Alternate names: grpE protein homolog 2, mitochondrial,
• Gene location: 5q32 (149345498: 149354582)     Exons: 4     NC_000005.10
• OMIM: 611748

Protein Summary

• Protein general information: Q8TAA5  
  • Name: GrpE protein homolog 2, mitochondrial (Mt GrpE#2)
  • Length: 225  
  • Mass: 25431
• Sequence:

  MAVRSLWAGRLRVQRLLAWSAAWESKGWPLPFSTATQRTAGEDCRSEDPPDELGPPLAERALRVKAVKLEKEVQD
  LTVRYQRAIADCENIRRRTQRCVEDAKIFGIQSFCKDLVEVADILEKTTECISEESEPEDQKLTLEKVFRGLLLL
  EAKLKSVFAKHGLEKLTPIGDKYDPHEHELICHVPAGVGVQPGTVALVRQDGYKLHGRTIRLARVEVAVESQRRL

• Structural information:
  • Interpro: IPR000740  IPR013805  IPR009012  
  • Prosite: PS01071
  • CDD: cd00446
  • STRING: ENSP00000329558
• Other Databases: GeneCards:  GRPEL2  Malacards:  GRPEL2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000774	adenyl-nucleotide exchange factor activity	IBA	molecular function
GO:0001405	PAM complex, Tim23 associated import motor	IBA	cellular component
GO:0030150	protein import into mitochondrial matrix	IBA	biological process
GO:0051082	unfolded protein binding	IBA	molecular function
GO:0006457	protein folding	IEA	biological process
GO:0042803	protein homodimerization activity	IEA	molecular function
GO:0000774	adenyl-nucleotide exchange factor activity	IEA	molecular function
GO:0051087	chaperone binding	IEA	molecular function
GO:0005739	mitochondrion	IEA	cellular component
GO:0051082	unfolded protein binding	IEA	molecular function
GO:0005759	mitochondrial matrix	IEA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0050790	regulation of catalytic activity	IEA	biological process
GO:0050790	regulation of catalytic activity	IEA	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881