• Gene id: 134218

Gene Summary

• Gene Symbol: DNAJC21   Gene   UCSC   Ensembl
• Aliases: BMFS3, DNAJA5, GS3, JJJ1
• Gene name: DnaJ heat shock protein family (Hsp40) member C21
• Alternate names: dnaJ homolog subfamily C member 21, DnaJ (Hsp40) homolog, subfamily C, member 21, DnaJ homology subfamily A member 5, JJJ1 DnaJ domain protein homolog, dnaJ homolog subfamily A member 5,
• Gene location: 5p13.2 (34929539: 34958963)     Exons: 14     NC_000005.10
• Gene summary(Entrez): This gene encodes a member of the DNAJ heat shock protein 40 family of proteins that is characterized by two N-terminal tetratricopeptide repeat domains and a C-terminal DNAJ domain. This protein binds the precursor 45S ribosomal RNA and may be involved i
• OMIM: 617048

Protein Summary

• Protein general information: Q5F1R6  
  • Name: DnaJ homolog subfamily C member 21 (DnaJ homolog subfamily A member 5) (Protein GS3)
  • Length: 531  
  • Mass: 62028
  • Tissue specificity: Expressed in brain, placenta, kidney and pancreas. {ECO
• Sequence:

  MKCHYEALGVRRDASEEELKKAYRKLALKWHPDKNLDNAAEAAEQFKLIQAAYDVLSDPQERAWYDNHREALLKG
  GFDGEYQDDSLDLLRYFTVTCYSGYGDDEKGFYTVYRNVFEMIAKEELESVLEEEVDDFPTFGDSQSDYDTVVHP
  FYAYWQSFCTQKNFAWKEEYDTRQASNRWEKRAMEKENKKIRDKARKEKNELVRQLVAFIRKRDKRVQAHRKLVE
  EQNAEKARKAEEMRRQQKLKQAKLVEQYREQSWMTMANLEKELQEMEARYEKEFGDGSDENEMEEHELKDEEDGK
  DSDEAEDAELYDDLYCPACDKSFKTEKAMKNHEKSKKHREMVALLKQQLEEEEENFSRPQIDENPLDDNSEEEME
  DAPKQKLSKKQKKKKQKPAQNYDDNFNVNGPGEGVKVDPEDTNLNQDSAKELEDSPQENVSVTEIIKPCDDPKSE
  AKSVPKPKGKKTKDMKKPVRVPAEPQTMSVLISCTTCHSEFPSRNKLFDHLKATGHARAPSSSSLNSATSSQSKK
  EKRKNR

• Structural information:
  • Protein Domains: (3..6-)
    (/note="J-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00286"-)
  • Interpro: IPR001623  IPR018253  IPR036869  IPR003604  IPR022755   IPR036236  IPR013087  
  • Prosite: PS00636 PS50076 PS00028 PS50157
  • CDD: cd06257
  • STRING: ENSP00000371451
• Other Databases: GeneCards:  DNAJC21  Malacards:  DNAJC21

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0008270	zinc ion binding	IEA	molecular function
GO:0003676	nucleic acid binding	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005730	nucleolus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0003723	RNA binding	HDA	molecular function
GO:0006457	protein folding	NAS	biological process
GO:0005840	ribosome	NAS	cellular component

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)