• Gene id: 133482

Gene Summary

• Gene Symbol: SLCO6A1   Gene   UCSC   Ensembl
• Aliases: CT48, GST, OATP-I, OATP6A1, OATPY
• Gene name: solute carrier organic anion transporter family member 6A1
• Alternate names: solute carrier organic anion transporter family member 6A1, cancer/testis antigen 48, gonad-specific transporter, organic anion-transporting polypeptide I, solute carrier family 21 member 19, testicular tissue protein Li 174, testis-specific organic anion trans,
• Gene location: 5q21.1 (102502212: 102371773)     Exons: 14     NC_000005.10
• OMIM: 613365

Protein Summary

• Protein general information: Q86UG4  
  • Name: Solute carrier organic anion transporter family member 6A1 (Cancer/testis antigen 48) (CT48) (Gonad specific transporter) (GST) (Organic anion transporting polypeptide 6A1) (Organic anion transporting polypeptide I) (OATP I) (Solute carrier family 21 memb
  • Length: 719  
  • Mass: 79232
  • Tissue specificity: Strongly expressed in testis. Weakly expressed in spleen, brain, fetal brain and placenta. Detected in lung tumors. {ECO
• Sequence:

  MFVGVARHSGSQDEVSRGVEPLEAARAQPAKDRRAKGTPKSSKPGKKHRYLRLLPEALIRFGGFRKRKKAKSSVS
  KKPGEVDDSLEQPCGLGCLVSTCCECCNNIRCFMIFYCILLICQGVVFGLIDVSIGDFQKEYQLKTIEKLALEKS
  YDISSGLVAIFIAFYGDRKKVIWFVASSFLIGLGSLLCAFPSINEENKQSKVGIEDICEEIKVVSGCQSSGISFQ
  SKYLSFFILGQTVQGIAGMPLYILGITFIDENVATHSAGIYLGIAECTSMIGYALGYVLGAPLVKVPENTTSATN
  TTVNNGSPEWLWTWWINFLFAAVVAWCTLIPLSCFPNNMPGSTRIKARKRKQLHFFDSRLKDLKLGTNIKDLCAA
  LWILMKNPVLICLALSKATEYLVIIGASEFLPIYLENQFILTPTVATTLAGLVLIPGGALGQLLGGVIVSTLEMS
  CKALMRFIMVTSVISLILLVFIIFVRCNPVQFAGINEDYDGTGKLGNLTAPCNEKCRCSSSIYSSICGRDDIEYF
  SPCFAGCTYSKAQNQKKMYYNCSCIKEGLITADAEGDFIDARPGKCDAKCYKLPLFIAFIFSTLIFSGFSGVPIV
  LAMTRVVPDKLRSLALGVSYVILRIFGTIPGPSIFKMSGETSCILRDVNKCGHTGRCWIYNKTKMAFLLVGICFL
  CKLCTIIFTTIAFFIYKRRLNENTDFPDVTVKNPKVKKKEETDL

• Structural information:
  • Protein Domains: (496..55-)
    (/note="Kazal-like-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00798"-)
  • Interpro: IPR002350  IPR036058  IPR036259  IPR004156  
  • Prosite: PS51465
  • STRING: ENSP00000421339
• Other Databases: GeneCards:  SLCO6A1  Malacards:  SLCO6A1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005887	integral component of plasma membrane	IBA	cellular component
GO:0043252	sodium-independent organic anion transport	IBA	biological process
GO:0015347	sodium-independent organic anion transmembrane transporter activity	IBA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0055085	transmembrane transport	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)