• Gene id: 133396

Gene Summary

• Gene Symbol: IL31RA   Gene   UCSC   Ensembl
• Aliases: CRL, CRL3, GLM-R, GLMR, GPL, IL-31RA, PLCA2, PRO21384, hGLM-R
• Gene name: interleukin 31 receptor A
• Alternate names: interleukin-31 receptor subunit alpha, IL-31 receptor subunit alpha, IL-31R subunit alpha, class I cytokine receptor, cytokine receptor-like 3, gp130-like monocyte receptor, soluble type I cytokine receptor CRL3, zcytoR17,
• Gene location: 5q11.2 (55840333: 55922853)     Exons: 20     NC_000005.10
• Gene summary(Entrez): The protein encoded by this gene belongs to the type I cytokine receptor family. This receptor, with homology to gp130, is expressed on monocytes, and is involved in IL-31 signaling via activation of STAT-3 and STAT-5. It functions either as a monomer, or
• OMIM: 611917

Protein Summary

• Protein general information: Q8NI17  
  • Name: Interleukin 31 receptor subunit alpha (IL 31 receptor subunit alpha) (IL 31R subunit alpha) (IL 31R alpha) (IL 31RA) (Cytokine receptor like 3) (GLM R) (hGLM R) (Gp130 like monocyte receptor) (Gp130 like receptor) (ZcytoR17)
  • Length: 732  
  • Mass: 82954
  • Tissue specificity: Expressed in CD14- and CD56-positive blood cells (PubMed
• Sequence:

  MMWTWALWMLPSLCKFSLAALPAKPENISCVYYYRKNLTCTWSPGKETSYTQYTVKRTYAFGEKHDNCTTNSSTS
  ENRASCSFFLPRITIPDNYTIEVEAENGDGVIKSHMTYWRLENIAKTEPPKIFRVKPVLGIKRMIQIEWIKPELA
  PVSSDLKYTLRFRTVNSTSWMEVNFAKNRKDKNQTYNLTGLQPFTEYVIALRCAVKESKFWSDWSQEKMGMTEEE
  APCGLELWRVLKPAEADGRRPVRLLWKKARGAPVLEKTLGYNIWYYPESNTNLTETMNTTNQQLELHLGGESFWV
  SMISYNSLGKSPVATLRIPAIQEKSFQCIEVMQACVAEDQLVVKWQSSALDVNTWMIEWFPDVDSEPTTLSWESV
  SQATNWTIQQDKLKPFWCYNISVYPMLHDKVGEPYSIQAYAKEGVPSEGPETKVENIGVKTVTITWKEIPKSERK
  GIICNYTIFYQAEGGKGFSKTVNSSILQYGLESLKRKTSYIVQVMASTSAGGTNGTSINFKTLSFSVFEIILITS
  LIGGGLLILIILTVAYGLKKPNKLTHLCWPTVPNPAESSIATWHGDDFKDKLNLKESDDSVNTEDRILKPCSTPS
  DKLVIDKLVVNFGNVLQEIFTDEARTGQENNLGGEKNGYVTCPFRPDCPLGKSFEELPVSPEIPPRKSQYLRSRM
  PEGTRPEAKEQLLFSGQSLVPDHLCEEGAPNPYLKNSVTAREFLVSEKLPEHTKGEV

• Structural information:
  • Protein Domains: (24..12-)
    1 (/note="Fibronectin-type-III)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00316-)
    (124..22-)
    2 (/note="Fibronectin-type-III)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00316-)
    (223..31-)
    3 (/note="Fibronectin-type-III)
    (/ev-)
  • Interpro: IPR003961  IPR036116  IPR013783  IPR015321  
  • Prosite: PS50853
  • CDD: cd00063
  • STRING: ENSP00000415900
• Other Databases: GeneCards:  IL31RA  Malacards:  IL31RA

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0019221	cytokine-mediated signaling pathway	IBA	biological process
GO:0019955	cytokine binding	IBA	molecular function
GO:0043235	receptor complex	IBA	cellular component
GO:0004896	cytokine receptor activity	IBA	molecular function
GO:0009897	external side of plasma membrane	IBA	cellular component
GO:0042531	positive regulation of tyrosine phosphorylation of STAT protein	IBA	biological process
GO:0030054	cell junction	IEA	cellular component
GO:0042995	cell projection	IEA	cellular component
GO:0002376	immune system process	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0045202	synapse	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0019221	cytokine-mediated signaling pathway	TAS	biological process
GO:0035745	T-helper 2 cell cytokine production	IEA	biological process
GO:0019955	cytokine binding	IEA	molecular function
GO:0002438	acute inflammatory response to antigenic stimulus	IEA	biological process
GO:0002067	glandular epithelial cell differentiation	IEA	biological process
GO:0098542	defense response to other organism	IEA	biological process
GO:0009897	external side of plasma membrane	IEA	cellular component
GO:0042734	presynaptic membrane	IEA	cellular component
GO:0030424	axon	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0008284	positive regulation of cell population proliferation	IDA	biological process
GO:0042531	positive regulation of tyrosine phosphorylation of STAT protein	IEP	biological process
GO:0030225	macrophage differentiation	NAS	biological process
GO:0016021	integral component of membrane	NAS	cellular component
GO:0000165	MAPK cascade	NAS	biological process
GO:0019955	cytokine binding	NAS	molecular function
GO:0043031	negative regulation of macrophage activation	NAS	biological process
GO:0030224	monocyte differentiation	IEP	biological process
GO:0019901	protein kinase binding	NAS	molecular function
GO:0007169	transmembrane receptor protein tyrosine kinase signaling pathway	NAS	biological process
GO:0004896	cytokine receptor activity	TAS	molecular function
GO:0003713	transcription coactivator activity	NAS	molecular function
GO:0045893	positive regulation of transcription, DNA-templated	NAS	biological process
GO:0043066	negative regulation of apoptotic process	NAS	biological process
GO:0042592	homeostatic process	NAS	biological process
GO:0019221	cytokine-mediated signaling pathway	TAS	biological process
GO:0007259	receptor signaling pathway via JAK-STAT	IEP	biological process
GO:0006952	defense response	NAS	biological process

KEGG pathways

Pathway id	Pathway name
hsa04060	Cytokine-cytokine receptor interaction

Diseases

Associated diseases	References
Primary localized cutaneous amyloidosis	KEGG:H01217
Primary localized cutaneous amyloidosis	KEGG:H01217
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881