About Us

Search Result


Gene id 133121
Gene Summary    Protein Summary    Gene ontology    KEGG pathways    Diseases    PubMed    

Gene Summary

Gene Symbol ENPP6   Gene   UCSC   Ensembl
Aliases NPP6
Gene name ectonucleotide pyrophosphatase/phosphodiesterase 6
Alternate names glycerophosphocholine cholinephosphodiesterase ENPP6, B830047L21Rik, E-NPP 6, GPC-Cpde, NPP-6, choline-specific glycerophosphodiester phosphodiesterase, ectonucleotide pyrophosphatase/phosphodiesterase family member 6, glycerophosphocholine cholinephosphodiester,
Gene location 4q35.1 (184217872: 184088705)     Exons: 8     NC_000004.12

Protein Summary

Protein general information Q6UWR7  

Name: Glycerophosphocholine cholinephosphodiesterase ENPP6 (GPC Cpde) (EC 3.1.4. ) (EC 3.1.4.38) (Choline specific glycerophosphodiester phosphodiesterase) (Ectonucleotide pyrophosphatase/phosphodiesterase family member 6) (E NPP 6) (NPP 6)

Length: 440  Mass: 50241

Tissue specificity: Predominantly expressed in kidney and brain. In the kidney, expressed specifically in the proximal tubules and thin descending limbs of Henle (at protein level). {ECO

Sequence MAVKLGTLLLALALGLAQPASARRKLLVFLLDGFRSDYISDEALESLPGFKEIVSRGVKVDYLTPDFPSLSYPNY
YTLMTGRHCEVHQMIGNYMWDPTTNKSFDIGVNKDSLMPLWWNGSEPLWVTLTKAKRKVYMYYWPGCEVEILGVR
PTYCLEYKNVPTDINFANAVSDALDSFKSGRADLAAIYHERIDVEGHHYGPASPQRKDALKAVDTVLKYMTKWIQ
ERGLQDRLNVIIFSDHGMTDIFWMDKVIELNKYISLNDLQQVKDRGPVVSLWPAPGKHSEIYNKLSTVEHMTVYE
KEAIPSRFYYKKGKFVSPLTLVADEGWFITENREMLPFWMNSTGRREGWQRGWHGYDNELMDMRGIFLAFGPDFK
SNFRAAPIRSVDVYNVMCNVVGITPLPNNGSWSRVMCMLKGRASTAPPVWPSHCALALILLFLLA
Structural information
Interpro:  IPR017850  IPR029889  IPR002591  
STRING:   ENSP00000296741
Other Databases GeneCards:  ENPP6  Malacards:  ENPP6

Gene ontology

Expand All | Collapse All

GO accessionTerm nameEvidence codeGo category
GO:0005886 plasma membrane
IBA cellular component
GO:0006629 lipid metabolic process
IBA biological process
GO:0008889 glycerophosphodiester pho
sphodiesterase activity
IBA molecular function
GO:0019695 choline metabolic process
IBA biological process
GO:0047390 glycerophosphocholine cho
linephosphodiesterase act
ivity
IDA molecular function
GO:0005576 extracellular region
IDA cellular component
GO:0019695 choline metabolic process
IDA biological process
GO:0008081 phosphoric diester hydrol
ase activity
IDA molecular function
GO:0006629 lipid metabolic process
IDA biological process
GO:0005886 plasma membrane
IDA cellular component
GO:0047390 glycerophosphocholine cho
linephosphodiesterase act
ivity
IEA molecular function
GO:0003824 catalytic activity
IEA molecular function
GO:0005886 plasma membrane
IEA cellular component
GO:0016787 hydrolase activity
IEA molecular function
GO:0046872 metal ion binding
IEA molecular function
GO:0006629 lipid metabolic process
IEA biological process
GO:0016020 membrane
IEA cellular component
GO:0031225 anchored component of mem
brane
IEA cellular component
GO:0016042 lipid catabolic process
IEA biological process
GO:0005886 plasma membrane
IEA cellular component
GO:0047390 glycerophosphocholine cho
linephosphodiesterase act
ivity
IEA molecular function
GO:0047390 glycerophosphocholine cho
linephosphodiesterase act
ivity
EXP molecular function
GO:0005886 plasma membrane
TAS cellular component
GO:0046475 glycerophospholipid catab
olic process
TAS biological process
GO:0005515 protein binding
IPI molecular function
GO:0019695 choline metabolic process
IEA biological process
GO:0008889 glycerophosphodiester pho
sphodiesterase activity
IEA molecular function
GO:0005886 plasma membrane
IEA cellular component
GO:0047390 glycerophosphocholine cho
linephosphodiesterase act
ivity
IEA molecular function
GO:0005886 plasma membrane
IEA cellular component
GO:0070062 extracellular exosome
HDA cellular component

KEGG pathways

Expand All | Collapse All

Pathway idPathway name
hsa00565Ether lipid metabolism
Associated diseases References
Cryptorchidism MIK: 28606200

PubMed references

Expand All | Collapse All

PMID Condition Mutation Ethnicity Population details Infertility_type Associated_genes Abstract
28606200 Cryptorchi
dism

Monozgotic twin
s (1 control, I
cwith cryptorc
hidism)
Male infertility MeDIP-Seq
Show abstract