• Gene id: 132946

Gene Summary

• Gene Symbol: ARL9   Gene   UCSC   Ensembl
• Gene name: ADP ribosylation factor like GTPase 9
• Alternate names: ADP-ribosylation factor-like protein 9, ADP-ribosylation factor-like 9,
• Gene location: 4q12 (97928440: 97851676)     Exons: 16     NC_000007.14
• Gene summary(Entrez): ARL9 is a member of the small GTPase protein family with a high degree of similarity to ARF (MIM 103180) proteins of the RAS superfamily.[supplied by OMIM, Nov 2008]
• OMIM: 612405

Protein Summary

• Protein general information: Q6T311  
  • Name: ADP ribosylation factor like protein 9
  • Length: 187  
  • Mass: 20755
• Sequence:

  MRPTWKALSHPAWPEEKNKQILVLGLDGAGKTSVLHSLASNRVQHSVAPTQGFHAVCINTEDSQMEFLEIGGSKP
  FRSYWEMYLSKGLLLIFVVDSADHSRLPEAKKYLHQLIAANPVLPLVVFANKQDLEAAYHITDIHEALALSEVGN
  DRKMFLFGTYLTKNGSEIPSTMQDAKDLIAQLAADVQ

• Structural information:
  • Interpro: IPR027417  IPR005225  IPR006689  
  • Prosite: PS51417
  • STRING: ENSP00000353210
• Other Databases: GeneCards:  ARL9  Malacards:  ARL9

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005525	GTP binding	IEA	molecular function
GO:0000166	nucleotide binding	IEA	molecular function
GO:0005525	GTP binding	IEA	molecular function

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)