• Gene id: 132724

Gene Summary

• Gene Symbol: TMPRSS11B   Gene   UCSC   Ensembl
• Aliases: HATL5
• Gene name: transmembrane serine protease 11B
• Alternate names: transmembrane protease serine 11B, airway trypsin-like protease 5, transmembrane protease, serine 11B,
• Gene location: 4q13.2 (3063606: 3062668)     Exons: 1     NC_000017.11

Protein Summary

• Protein general information: Q86T26  
  • Name: Transmembrane protease serine 11B (EC 3.4.21. ) (Airway trypsin like protease 5)
  • Length: 416  
  • Mass: 46337
• Sequence:

  MYRHGISSQRSWPLWTTIFIFLGVAAILGVTIGLLVHFLAVEKTYYYQGDFHISGVTYNDNCENAASQASTNLSK
  DIETKMLNAFQNSSIYKEYVKSEVIKLLPNANGSNVQLQLKFKFPPAEGVSMRTKIKAKLHQMLKNNMASWNAVP
  ASIKLMEISKAASEMLTNNCCGRQVANSIITGNKIVNGKSSLEGAWPWQASMQWKGRHYCGASLISSRWLLSAAH
  CFAKKNNSKDWTVNFGIVVNKPYMTRKVQNIIFHENYSSPGLHDDIALVQLAEEVSFTEYIRKICLPEAKMKLSE
  NDNVVVTGWGTLYMNGSFPVILQEDFLKIIDNKICNASYAYSGFVTDTMLCAGFMSGEADACQNDSGGPLAYPDS
  RNIWHLVGIVSWGDGCGKKNKPGVYTRVTSYRNWITSKTGL

• Structural information:
  • Protein Domains: (43..16-)
    (/note="SEA-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00188-)
    (185..41-)
    (/note="Peptidase-S1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00274"-)
  • Interpro: IPR017329  IPR009003  IPR001314  IPR000082  IPR036364   IPR001254  IPR018114  
  • Prosite: PS50024 PS50240 PS00134
  • CDD: cd00190
• Other Databases: GeneCards:  TMPRSS11B  Malacards:  TMPRSS11B

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005886	plasma membrane	IBA	cellular component
GO:0008236	serine-type peptidase activity	IDA	molecular function
GO:0005886	plasma membrane	IDA	cellular component
GO:0004252	serine-type endopeptidase activity	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0006508	proteolysis	IEA	biological process
GO:0005887	integral component of plasma membrane	IEA	cellular component
GO:0008233	peptidase activity	IEA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0006508	proteolysis	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0008236	serine-type peptidase activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0008150	biological_process	ND	biological process
GO:0070062	extracellular exosome	HDA	cellular component

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)