• Gene id: 1326

Gene Summary

• Gene Symbol: MAP3K8   Gene   UCSC   Ensembl
• Aliases: AURA2, COT, EST, ESTF, MEKK8, TPL2, Tpl-2, c-COT
• Gene name: mitogen-activated protein kinase kinase kinase 8
• Alternate names: mitogen-activated protein kinase kinase kinase 8, Ewing sarcoma transformant, augmented in rheumatoid arthritis 2, cot (cancer Osaka thyroid) oncogene, proto-oncogene c-Cot, proto-oncogene serine/threoine protein kinase, tumor progression locus 2,
• Gene location: 10p11.23 (57591903: 57685363)     Exons: 13     NC_000015.10
• Gene summary(Entrez): This gene is an oncogene that encodes a member of the serine/threonine protein kinase family. The encoded protein localizes to the cytoplasm and can activate both the MAP kinase and JNK kinase pathways. This protein was shown to activate IkappaB kinases,
• OMIM: 191195

Protein Summary

• Protein general information: P41279  
  • Name: Mitogen activated protein kinase kinase kinase 8 (EC 2.7.11.25) (Cancer Osaka thyroid oncogene) (Proto oncogene c Cot) (Serine/threonine protein kinase cot) (Tumor progression locus 2) (TPL 2)
  • Length: 467  
  • Mass: 52925
  • Tissue specificity: Expressed in several normal tissues and human tumor-derived cell lines.
• Sequence:

  MEYMSTGSDNKEEIDLLIKHLNVSDVIDIMENLYASEEPAVYEPSLMTMCQDSNQNDERSKSLLLSGQEVPWLSS
  VRYGTVEDLLAFANHISNTAKHFYGQRPQESGILLNMVITPQNGRYQIDSDVLLIPWKLTYRNIGSDFIPRGAFG
  KVYLAQDIKTKKRMACKLIPVDQFKPSDVEIQACFRHENIAELYGAVLWGETVHLFMEAGEGGSVLEKLESCGPM
  REFEIIWVTKHVLKGLDFLHSKKVIHHDIKPSNIVFMSTKAVLVDFGLSVQMTEDVYFPKDLRGTEIYMSPEVIL
  CRGHSTKADIYSLGATLIHMQTGTPPWVKRYPRSAYPSYLYIIHKQAPPLEDIADDCSPGMRELIEASLERNPNH
  RPRAADLLKHEALNPPREDQPRCQSLDSALLERKRLLSRKELELPENIADSSCTGSTEESEMLKRQRSLYIDLGA
  LAGYFNLVRGPPTLEYG

• Structural information:
  • Protein Domains: (138..38-)
    (/note="Protein-kinase)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00159"-)
  • Interpro: IPR011009  IPR017424  IPR000719  IPR008271  
  • Prosite: PS50011 PS00108
  • PDB: 4Y83 4Y85 5IU2
  • PDBsum: 4Y83 4Y85 5IU2
  • DIP: 27534
  • STRING: ENSP00000263056
• Other Databases: GeneCards:  MAP3K8  Malacards:  MAP3K8

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004674	protein serine/threonine kinase activity	IBA	molecular function
GO:0005737	cytoplasm	IBA	cellular component
GO:0007346	regulation of mitotic cell cycle	IBA	biological process
GO:0032147	activation of protein kinase activity	IBA	biological process
GO:0023014	signal transduction by protein phosphorylation	IBA	biological process
GO:0031098	stress-activated protein kinase signaling cascade	IBA	biological process
GO:0000287	magnesium ion binding	IEA	molecular function
GO:0004709	MAP kinase kinase kinase activity	IEA	molecular function
GO:0007165	signal transduction	IEA	biological process
GO:0004672	protein kinase activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0006468	protein phosphorylation	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0002376	immune system process	IEA	biological process
GO:0016740	transferase activity	IEA	molecular function
GO:0016301	kinase activity	IEA	molecular function
GO:0000166	nucleotide binding	IEA	molecular function
GO:0016310	phosphorylation	IEA	biological process
GO:0004674	protein serine/threonine kinase activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005524	ATP binding	IEA	molecular function
GO:0007049	cell cycle	IEA	biological process
GO:0004674	protein serine/threonine kinase activity	TAS	molecular function
GO:0006468	protein phosphorylation	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0004709	MAP kinase kinase kinase activity	IEA	molecular function
GO:0070498	interleukin-1-mediated signaling pathway	TAS	biological process
GO:0004709	MAP kinase kinase kinase activity	TAS	molecular function
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0031295	T cell costimulation	TAS	biological process
GO:0051403	stress-activated MAPK cascade	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0000186	activation of MAPKK activity	IEA	biological process
GO:0000186	activation of MAPKK activity	IEA	biological process
GO:0000186	activation of MAPKK activity	IEA	biological process

KEGG pathways

Pathway id	Pathway name
hsa04010	MAPK signaling pathway
hsa04668	TNF signaling pathway
hsa04660	T cell receptor signaling pathway
hsa04620	Toll-like receptor signaling pathway

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881