• Gene id: 1325

Gene Summary

• Gene Symbol: CORT   Gene   UCSC   Ensembl
• Aliases: CST-14, CST-17, CST-29
• Gene name: cortistatin
• Alternate names: cortistatin, cortistatin-14, cortistatin-17, cortistatin-29, prepro-cortistatin, preprocortistatin,
• Gene location: 1p36.22 (10450030: 10451997)     Exons: 2     NC_000001.11
• Gene summary(Entrez): This gene encodes a neuropeptide that is structurally similar to somatostatin. It binds to all known somatostatin receptors, and shares many pharmacological and functional properties with somatostatin, including the depression of neuronal activity. Howeve
• OMIM: 602784

Protein Summary

• Protein general information: O00230  
  • Name: Cortistatin [Cleaved into: Cortistatin 29; Cortistatin 17]
  • Length: 105  
  • Mass: 11532
  • Tissue specificity: Expressed in a subset of GABAergic cells in the cortex and hippocampus.
• Sequence:

  MPLSPGLLLLLLSGATATAALPLEGGPTGRDSEHMQEAAGIRKSSLLTFLAWWFEWTSQASAGPLIGEEAREVAR
  RQEGAPPQQSARRDRMPCRNFFWKTFSSCK

• Structural information:
  • Interpro: IPR004250  IPR018142  
  • STRING: ENSP00000366248
• Other Databases: GeneCards:  CORT  Malacards:  CORT

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001664	G protein-coupled receptor binding	IBA	molecular function
GO:0005184	neuropeptide hormone activity	IBA	molecular function
GO:0007193	adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway	IBA	biological process
GO:0043240	Fanconi anaemia nuclear complex	IBA	NOT|cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0005179	hormone activity	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0005179	hormone activity	IEA	molecular function
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0045202	synapse	IEA	cellular component
GO:0007193	adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway	IDA	biological process
GO:0005184	neuropeptide hormone activity	IDA	molecular function
GO:0005615	extracellular space	NAS	cellular component
GO:0007268	chemical synaptic transmission	NAS	biological process
GO:0001664	G protein-coupled receptor binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04080	Neuroactive ligand-receptor interaction

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray