• Gene id: 132320

Gene Summary

• Gene Symbol: SCLT1   Gene   UCSC   Ensembl
• Aliases: CAP-1A, CAP1A
• Gene name: sodium channel and clathrin linker 1
• Alternate names: sodium channel and clathrin linker 1, sodium channel-associated protein 1,
• Gene location: 4q28.2 (129093579: 128874389)     Exons: 4     NC_000004.12
• Gene summary(Entrez): This gene encodes an adaptor protein. Studies of a related gene in rat suggest that the encoded protein functions to link clathrin to the sodium channel protein type 10 subunit alpha protein. The encoded protein has also been identified as a component of
• OMIM: 611399

Protein Summary

• Protein general information: Q96NL6  
  • Name: Sodium channel and clathrin linker 1 (Sodium channel associated protein 1)
  • Length: 688  
  • Mass: 80910
• Sequence:

  MAAEIDFLREQNRRLNEDFRRYQMESFSKYSSVQKAVCQGEGDDTFENLVFDQSFLAPLVTEYDKHLGELNGQLK
  YYQKQVGEMKLQLENVIKENERLHSELKDAVEKKLEAFPLGTEVGTDIYADDETVRNLQEQLQLANQEKTQAVEL
  WQTVSQELDRLHKLYQEHMTEAQIHVFESQKQKDQLFDFQQLTKQLHVTNENMEVTNQQFLKTVTEQSVIIEQLR
  KKLRQAKLELRVAVAKVEELTNVTEDLQGQMKKKEKDVVSAHGREEASDRRLQQLQSSIKQLEIRLCVTIQEANQ
  LRTENTHLEKQTRELQAKCNELENERYEAIVRARNSMQLLEEANLQKSQALLEEKQKEEDIEKMKETVSRFVQDA
  TIRTKKEVANTKKQCNIQISRLTEELSALQMECAEKQGQIERVIKEKKAVEEELEKIYREGRGNESDYRKLEEMH
  QRFLVSERSKDDLQLRLTRAENRIKQLETDSSEEISRYQEMIQKLQNVLESERENCGLVSEQRLKLQQENKQLRK
  ETESLRKIALEAQKKAKVKISTMEHEFSIKERGFEVQLREMEDSNRNSIVELRHLLATQQKAANRWKEETKKLTE
  SAEIRINNLKSELSRQKLHTQELLSQLEMANEKVAENEKLILEHQEKANRLQRRLSQAEERAASASQQLSVITVQ
  RRKAASLMNLENI

• Structural information:
  • Interpro: IPR038911  
  • STRING: ENSP00000281142
• Other Databases: GeneCards:  SCLT1  Malacards:  SCLT1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005813	centrosome	IDA	cellular component
GO:0005814	centriole	IDA	cellular component
GO:0060271	cilium assembly	IMP	biological process
GO:0045162	clustering of voltage-gated sodium channels	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0097539	ciliary transition fiber	IDA	cellular component
GO:0060271	cilium assembly	IMP	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0097711	ciliary basal body-plasma membrane docking	TAS	biological process
GO:0071439	clathrin complex	IEA	cellular component
GO:0008022	protein C-terminus binding	IEA	molecular function
GO:0005814	centriole	IEA	cellular component
GO:0045162	clustering of voltage-gated sodium channels	IEA	biological process
GO:0030276	clathrin binding	IEA	molecular function
GO:0017080	sodium channel regulator activity	IEA	molecular function
GO:0005814	centriole	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq