• Gene id: 132243

Gene Summary

• Gene Symbol: H1-8   Gene   UCSC   Ensembl
• Aliases: H1.8, H1FOO, H1oo, osH1
• Gene name: H1.8 linker histone
• Alternate names: histone H1.8, histone H1oo, H1 histone family member O oocyte specific, oocyte-specific histone H1, oocyte-specific linker histone H1,
• Gene location: 3q22.1 (129543174: 129555184)     Exons: 8     NC_000003.12
• Gene summary(Entrez): Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Nucleosomes consist of approximately 146 bp of DNA wrapped around a histone octamer composed of pairs of each of the four core hi

Protein Summary

• Protein general information: Q8IZA3  
  • Name: Histone H1.8 (Histone H1oo) (Oocyte specific histone H1) (Oocyte specific linker histone H1) (osH1)
  • Length: 346  
  • Mass: 35813
  • Tissue specificity: Oocyte-specific. {ECO
• Sequence:

  MAPGSVTSDISPSSTSTAGSSRSPESEKPGPSHGGVPPGGPSHSSLPVGRRHPPVLRMVLEALQAGEQRRGTSVA
  AIKLYILHKYPTVDVLRFKYLLKQALATGMRRGLLARPLNSKARGATGSFKLVPKHKKKIQPRKMAPATAPRRAG
  EAKGKGPKKPSEAKEDPPNVGKVKKAAKRPAKVQKPPPKPGAATEKARKQGGAAKDTRAQSGEARKVPPKPDKAM
  RAPSSAGGLSRKAKAKGSRSSQGDAEAYRKTKAESKSSKPTASKVKNGAASPTKKKVVAKAKAPKAGQGPNTKAA
  APAKGSGSKVVPAHLSRKTEAPKGPRKAGLPIKASSSKVSSQRAEA

• Structural information:
  • Protein Domains: (51..12-)
    (/note="H15-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00837"-)
  • Interpro: IPR005818  IPR036388  IPR036390  
  • Prosite: PS51504
  • CDD: cd00073
  • STRING: ENSP00000319799
• Other Databases: GeneCards:  H1-8  Malacards:  H1-8

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0003690	double-stranded DNA binding	IBA	molecular function
GO:0030261	chromosome condensation	IBA	biological process
GO:0031492	nucleosomal DNA binding	IBA	molecular function
GO:0045910	negative regulation of DNA recombination	IBA	biological process
GO:0005634	nucleus	IBA	cellular component
GO:0006355	regulation of transcription, DNA-templated	IBA	biological process
GO:0016584	nucleosome positioning	IBA	biological process
GO:0031936	negative regulation of chromatin silencing	IBA	biological process
GO:0000786	nucleosome	IEA	cellular component
GO:0006334	nucleosome assembly	IEA	biological process
GO:0042025	host cell nucleus	IEA	cellular component
GO:0003677	DNA binding	IEA	molecular function
GO:0051321	meiotic cell cycle	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005694	chromosome	IEA	cellular component
GO:0003677	DNA binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005694	chromosome	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0044030	regulation of DNA methylation	ISS	biological process
GO:0016584	nucleosome positioning	ISS	biological process
GO:0005634	nucleus	ISS	cellular component
GO:2000737	negative regulation of stem cell differentiation	ISS	biological process
GO:0070062	extracellular exosome	HDA	cellular component
GO:0031492	nucleosomal DNA binding	ISS	molecular function
GO:0005730	nucleolus	ISS	NOT|cellular component

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)